KEGG   Homo sapiens (human): 79897Help
Entry
79897             CDS       T01001                                 

Gene name
RPP21, C6orf135, CAT60
Definition
(RefSeq) ribonuclease P/MRP subunit p21
  KO
K03540  ribonuclease P protein subunit RPR2 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    79897 (RPP21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    79897 (RPP21)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     79897 (RPP21)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    79897 (RPP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rpr2
Motif
Other DBs
NCBI-GeneID: 79897
NCBI-ProteinID: NP_079115
OMIM: 612524
HGNC: 21300
Ensembl: ENSG00000241370
Vega: OTTHUMG00000031220
Pharos: Q9H633(Tdark)
UniProt: Q9H633
Position
6p22.1
AA seq 154 aa AA seqDB search
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRT
LCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGS
QADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcggggccggtgaaggaccgcgaggccttccagaggctcaacttcctgtaccaggcc
gcccattgtgtccttgcccaggaccccgagaaccaggcgctggcgaggttttactgctac
actgagaggaccattgcgaagcggctcgtcttgcggcgggatccctcggtgaagaggact
ctctgtcgaggctgctcttccctcctcgtcccgggcctcacctgcacccagcgccagaga
cgctgcaggggacagcgctggaccgtacagacctgcctaacatgccagcgcagccaacgc
ttcctcaatgatcccgggcatttactctggggagacaggcctgaggcccagctcgggagc
caagcagattccaaaccactacaacccttgccaaacacagcccactccatttcagaccgc
cttcctgaggagaaaatgcagactcagggttccagtaaccagtga

DBGET integrated database retrieval system