KEGG   Homo sapiens (human): 799Help
Entry
799               CDS       T01001                                 

Gene name
CALCR, CRT, CT-R, CTR, CTR1
Definition
(RefSeq) calcitonin receptor
  KO
K04576  calcitonin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04380  Osteoclast differentiation
Disease
H01593  Osteoporosis
Drug target
Avicatonin: D09771
Calcitonin (salmon synthetic): D00249
Davalintide (DG01352): D09600 D09601
Elcatonin: D03287
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    799 (CALCR)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    799 (CALCR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    799 (CALCR)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    799 (CALCR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 799
NCBI-ProteinID: NP_001158210
OMIM: 114131
HGNC: 1440
Ensembl: ENSG00000004948
Vega: OTTHUMG00000023599
Pharos: P30988(Tclin)
UniProt: P30988 A0A0C4DG16
Structure
PDB: 

Position
7q21.3
AA seq 474 aa AA seqDB search
MRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQ
QLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFK
HPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQR
VTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCE
GIYLHTLIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYI
IHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFP
WRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRR
PSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcacatttacaagccggtgcttggcactgtttcttcttctaaatcacccaacc
ccaattcttcctgccttttcaaatcaaacctatccaacaatagagcccaagccatttctt
tacgtcgtaggacgaaagaagatgatggatgcacagtacaaatgctatgaccgaatgcag
cagttacccgcataccaaggagaaggtccatattgcaatcgcacctgggatggatggctg
tgctgggatgacacaccggctggagtattgtcctatcagttctgcccagattattttccg
gattttgatccatcagaaaaggttacaaaatactgtgatgaaaaaggtgtttggtttaaa
catcctgaaaacaatcgaacctggtccaactatactatgtgcaatgctttcactcctgag
aaactgaagaatgcatatgttctgtactatttggctattgtgggtcattctttgtcaatt
ttcaccctagtgatttccctggggattttcgtgtttttcaggagccttggctgccaaagg
gtaaccctgcacaagaacatgtttcttacttacattctgaattctatgattatcatcatc
cacctggttgaagtagtacccaatggagagctcgtgcgaagggacccggtgagctgcaag
attttgcattttttccaccagtacatgatggcctgcaactatttctggatgctctgtgaa
gggatctatcttcatacactcattgtcgtggctgtgtttactgagaagcaacgcttgcgg
tggtattatctcttgggctgggggttcccgctggtgccaaccactatccatgctattacc
agggccgtgtacttcaatgacaactgctggctgagtgtggaaacccatttgctttacata
atccatggacctgtcatggcggcacttgtggtcaatttcttctttttgctcaacattgtc
cgggtgcttgtgaccaaaatgagggaaacccatgaggcggaatcccacatgtacctgaag
gctgtgaaggccaccatgatccttgtgcccctgctgggaatccagtttgtcgtctttccc
tggagaccttccaacaagatgcttgggaagatatatgattacgtgatgcactctctgatt
catttccagggcttctttgttgcgaccatctactgcttctgcaacaatgaggtccaaacc
accgtgaagcgccaatgggcccaattcaaaattcagtggaaccagcgttgggggaggcgc
ccctccaaccgctctgctcgcgctgcagccgctgctgcggaggctggcgacatcccaatt
tacatctgccatcaggagctgaggaatgaaccagccaacaaccaaggcgaggagagtgct
gagatcatccctttgaatatcatagagcaagagtcatctgcttga

DBGET integrated database retrieval system