KEGG   Homo sapiens (human): 79902
Entry
79902             CDS       T01001                                 

Gene name
NUP85, FROUNT, NPHS17, Nup75
Definition
(RefSeq) nucleoporin 85
  KO
K14304  nuclear pore complex protein Nup85
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    79902 (NUP85)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    79902 (NUP85)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79902 (NUP85)
   03036 Chromosome and associated proteins [BR:hsa03036]
    79902 (NUP85)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     79902 (NUP85)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    79902 (NUP85)
SSDB
Motif
Pfam: Nucleopor_Nup85 TPR_4 TPR_19
Other DBs
NCBI-GeneID: 79902
NCBI-ProteinID: NP_079120
OMIM: 170285
HGNC: 8734
Ensembl: ENSG00000125450
Vega: OTTHUMG00000179482
Pharos: Q9BW27(Tbio)
UniProt: Q9BW27
Structure
PDB: 
5A9Q

Position
17q25.1
AA seq 656 aa
MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKD
VDVYSQILRKLFNESHGIFLGLQRIDEELTGKSRKSQLVRVSKNYRSVIRACMEEMHQVA
IAAKDPANGRQFSSQVSILSAMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSL
SADVLGSENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTM
PILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKEL
LSNWYHFLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQV
IKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLG
VDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRN
NRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGK
YREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYEL
MRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggaggagctcgatggcgagccaacagtcactttgattccaggcgtgaattccaagaag
aaccaaatgtattttgactggggtccaggggagatgctggtatgtgaaacctccttcaac
aaaaaagaaaaatcagagatggtgccaagttgcccctttatctatatcatccgtaaggat
gtagatgtttactctcaaatcttgagaaaactcttcaatgaatcccatggaatctttctg
ggcctccagagaattgacgaagagttgactggaaaatccagaaaatctcaattggttcga
gtgagtaaaaactaccgatcagtcatcagagcatgtatggaggaaatgcaccaggttgca
attgctgctaaagatccagccaatggccgccagttcagcagccaggtctccattttgtca
gcaatggagctcatctggaacctgtgtgagattctttttattgaagtggccccagctggc
cctctcctcctccatctccttgactgggtccggctccatgtgtgcgaggtggacagtttg
tcggcagatgttctgggcagtgagaatccaagcaaacatgacagcttctggaacttggtg
accatcttggtgctgcagggccggctggatgaggcccgacagatgctctccaaggaagcc
gatgccagccccgcctctgcaggcatatgccgaatcatgggggacctgatgaggacaatg
cccattcttagtcccgggaacacccagacactgacagagctggagctgaagtggcagcac
tggcacgaggaatgtgagcggtacctccaggacagcacattcgccaccagccctcacctg
gagtctctcttgaagattatgctgggagacgaagctgccttgttagagcagaaggaactt
ctgagtaattggtatcatttcctagtgactcggctcttgtactccaatcccacagtaaaa
cccattgatctgcactactatgcccagtccagcctggacctgtttctgggaggtgagagc
agcccagaacccctggacaacatcttgttggcagcctttgagtttgacatccatcaagta
atcaaagagtgcagcatcgccctgagcaactggtggtttgtggcccacctgacagacctg
ctggaccactgcaagctcctccagtcacacaacctctatttcggttccaacatgagagag
ttcctcctgctggagtacgcctcgggactgtttgctcatcccagcctgtggcagctgggg
gtcgattactttgattactgccccgagctgggccgagtctccctggagctgcacattgag
cggatacctctgaacaccgagcagaaagccctgaaggtgctgcggatctgtgagcagcgg
cagatgactgaacaagttcgcagcatttgtaagatcttagccatgaaagccgtccgcaac
aatcgcctgggttctgccctctcttggagcatccgtgctaaggatgccgcctttgccacg
ctcgtgtcagacaggttcctcagggattactgtgagcgaggctgcttttctgatttggat
ctcattgacaacctggggccagccatgatgctcagtgaccgactgacattcctgggaaag
tatcgcgagttccaccgtatgtacggggagaagcgttttgccgacgcagcttctctcctt
ctgtccttgatgacgtctcggattgcccctcggtctttctggatgactctgctgacagac
gccttgccccttttggaacagaaacaggtgattttctcagcagaacagacttatgagttg
atgcggtgtctggaggacttgacgtcaagaagacctgtgcatggagaatctgataccgag
cagctccaggatgatgacatagagaccaccaaggtggaaatgctgagactttctctggca
cgaaatcttgctcgggcaattataagagaaggctcactggaaggttcctga

DBGET integrated database retrieval system