KEGG   Homo sapiens (human): 79908Help
Entry
79908             CDS       T01001                                 

Gene name
BTNL8, BTN9.2
Definition
(RefSeq) butyrophilin like 8
  KO
K06712  butyrophilin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    79908 (BTNL8)
   04090 CD molecules [BR:hsa04090]
    79908 (BTNL8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   79908 (BTNL8)
CD molecules [BR:hsa04090]
 Proteins
  79908 (BTNL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PRY V-set I-set Ig_3
Motif
Other DBs
NCBI-GeneID: 79908
NCBI-ProteinID: NP_001035552
OMIM: 615606
HGNC: 26131
Ensembl: ENSG00000113303
Vega: OTTHUMG00000130932
Pharos: Q6UX41(Tdark)
UniProt: Q6UX41
Position
5q35.3
AA seq 500 aa AA seqDB search
MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQF
SSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQS
YYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSR
TNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATKVL
GILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPK
LCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNKRWRVGVCRD
DVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF
FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPE
TSNSESSSQATTPFLPRGEM
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatgctcagtttggttctgagtctcctcaagctgggatcagggcagtggcag
gtgtttgggccagacaagcctgtccaggccttggtgggggaggacgcagcattctcctgt
ttcctgtctcctaagaccaatgcagaggccatggaagtgcggttcttcaggggccagttc
tctagcgtggtccacctctacagggacgggaaggaccagccatttatgcagatgccacag
tatcaaggcaggacaaaactggtgaaggattctattgcggaggggcgcatctctctgagg
ctggaaaacattactgtgttggatgctggcctctatgggtgcaggattagttcccagtct
tactaccagaaggccatctgggagctacaggtgtcagcactgggctcagttcctctcatt
tccatcacgggatatgttgatagagacatccagctactctgtcagtcctcgggctggttc
ccccggcccacagcgaagtggaaaggtccacaaggacaggatttgtccacagactccagg
acaaacagagacatgcatggcctgtttgatgtggagatctctctgaccgtccaagagaac
gccgggagcatatcctgttccatgcggcatgctcatctgagccgagaggtggaatccagg
gtacagataggagatacctttttcgagcctatatcgtggcacctggctaccaaagtactg
ggaatactctgctgtggcctattttttggcattgttggactgaagattttcttctccaaa
ttccagtggaaaatccaggcggaactggactggagaagaaagcacggacaggcagaattg
agagacgcccggaaacacgcagtggaggtgactctggatccagagacggctcacccgaag
ctctgcgtttctgatctgaaaactgtaacccatagaaaagctccccaggaggtgcctcac
tctgagaagagatttacaaggaagagtgtggtggcttctcagagtttccaagcagggaaa
cattactgggaggtggacggaggacacaataaaaggtggcgcgtgggagtgtgccgggat
gatgtggacaggaggaaggagtacgtgactttgtctcccgatcatgggtactgggtcctc
agactgaatggagaacatttgtatttcacattaaatccccgttttatcagcgtcttcccc
aggaccccacctacaaaaataggggtcttcctggactatgagtgtgggaccatctccttc
ttcaacataaatgaccagtcccttatttataccctgacatgtcggtttgaaggcttattg
aggccctacattgagtatccgtcctataatgagcaaaatggaactcccatagtcatctgc
ccagtcacccaggaatcagagaaagaggcctcttggcaaagggcctctgcaatcccagag
acaagcaacagtgagtcctcctcacaggcaaccacgcccttcctccccaggggtgaaatg
tag

DBGET integrated database retrieval system