KEGG   Homo sapiens (human): 7991Help
Entry
7991              CDS       T01001                                 

Gene name
TUSC3, D8S1992, M33, MRT22, MRT7, MagT2, N33, OST3A
Definition
(RefSeq) tumor suppressor candidate 3
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    7991 (TUSC3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7991 (TUSC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7991 (TUSC3)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   7991 (TUSC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OST3_OST6 Thioredoxin Gram_pos_anchor DUF4131
Motif
Other DBs
NCBI-GeneID: 7991
NCBI-ProteinID: NP_006756
OMIM: 601385
HGNC: 30242
Ensembl: ENSG00000104723
Vega: OTTHUMG00000094803
Pharos: Q13454(Tbio)
UniProt: Q13454
Structure
PDB: 

Position
8p22
AA seq 348 aa AA seqDB search
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccggggcgctccttcacgccgtaggcaagcggggcggcggctgcggtacctg
cccaccgggagctttcccttccttctcctgctgctgctgctctgcatccagctcggggga
ggacagaagaaaaaggagaatcttttagctgaaaaagtagagcagctgatggaatggagt
tccagacgctcaatcttccgaatgaatggtgataaattccgaaaatttataaaggcacca
cctcgaaactattccatgattgttatgttcactgctcttcagcctcagcggcagtgttct
gtgtgcaggcaagctaatgaagaatatcaaatactggcgaactcctggcgctattcatct
gctttttgtaacaagctcttcttcagtatggtggactatgatgaggggacagacgttttt
cagcagctcaacatgaactctgctcctacattcatgcattttcctccaaaaggcagacct
aagagagctgatacttttgacctccaaagaattggatttgcagctgagcaactagcaaag
tggattgctgacagaacggatgttcatattcgggttttcagaccacccaactactctggt
accattgctttggccctgttagtgtcgcttgttggaggtttgctttatttgagaaggaac
aacttggagttcatctataacaagactggttgggccatggtgtctctgtgtatagtcttt
gctatgacttctggccagatgtggaaccatatccgtggacctccatatgctcataagaac
ccacacaatggacaagtgagctacattcatgggagcagccaggctcagtttgtggcagaa
tcacacattattctggtactgaatgccgctatcaccatggggatggttcttctaaatgaa
gcagcaacttcgaaaggcgatgttggaaaaagacggataatttgcctagtgggattgggc
ctggtggtcttcttcttcagttttctactttcaatatttcgttccaagtaccacggctat
ccttatagtgatctggactttgagtga

DBGET integrated database retrieval system