KEGG   Homo sapiens (human): 79913
Entry
79913             CDS       T01001                                 
Symbol
ACTR5, Arp5, INO80M
Name
(RefSeq) actin related protein 5
  KO
K11672  actin-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03082  ATP-dependent chromatin remodeling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09126 Chromosome
   03082 ATP-dependent chromatin remodeling
    79913 (ACTR5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79913 (ACTR5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    79913 (ACTR5)
   INO80 complex (yeast)
    79913 (ACTR5)
SSDB
Motif
Pfam: Actin DUF1542
Other DBs
NCBI-GeneID: 79913
NCBI-ProteinID: NP_079131
OMIM: 619730
HGNC: 14671
Ensembl: ENSG00000101442
UniProt: Q9H9F9
Structure
Position
20:38748460..38772520
AA seq 607 aa
MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQ
FRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSM
CSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSY
IQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYP
KDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDW
ALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
GGAGEQA
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggcggcgaacgtgttcccgttccgcgacgcccgtgccgcaccggacccagtgctggag
gccggcccggtggcacacgggccactgccggtaccgctggtgctggacaacgggtcgttc
caagtccgcgctggctgggcgtgtcccgggcaggacccaggtcccgagccgcgcctgcag
ttccgcgcggtgtgcgcccgcggtcgtggcggggcacggggcgcgtcgggcccgcaggtg
gggaacgctctgggcagcctggagccactgcgctggatgctgcgctcgcccttcgaccgc
aacgtgccggtcaacctggagcttcaggagttgctgctggactacagcttccagcacctg
ggtgtctcctcacagggctgtgttgatcatcccatagttttgacagaagctgtgtgcaac
ccactgtattcacggcaaatgatgtctgagcttctttttgagtgctacgggattcccaag
gttgcctatggaatagacagcctcttcagcttctaccacaataagccaaagaactcgatg
tgcagtgggctaatcatttcatctggataccagtgtacgcatgttttacccatcttagaa
gggagattagatgctaaaaactgcaagcgcatcaatcttggaggaagccaagcagctggt
tacctccagcgtctcctccagctgaagtaccctgggcacctggcagccatcaccctcagc
cgcatggaggagattctgcatgagcacagctacatcgctgaggattatgtggaagaatta
cacaaatggcggtgtcctgattattatgagaataatgtccacaagatgcagctcccattt
tccagcaagctcctgggcagcactctgacctctgaggagaaacaagaaaggcggcagcag
caattgcggcggctgcaggagctcaatgcccggcggcgggaggagaagctgcagctggat
caggagcgtctggaccgactgctatatgtgcaggaacttctagaggatggccagatggat
cagtttcacaaagctctgatagagctgaatatggactccccagaagagctgcagtcctac
atccagaagctcagtatagcagtggagcaggctaagcagaaaatcctccaagcggaagtc
aacctcgaggtggatgtggtagacagcaagccagagacccctgacctggagcagctggag
ccgtctttggaagatgtggaaagcatgaatgattttgatcccttgttttcagaggaaaca
cctggagtggagaagccggtcaccactgttcagcccgtgtttaacttggcagcatatcat
cagctatttgttgggacagaaagaattcgagctccagagattattttccagccatctctc
ataggagaagaacaggctgggattgcagagactcttcagtacattctggacaggtaccca
aaggacattcaggaaatgctggttcagaacgttttcctcactggcggcaacacgatgtat
cctggcatgaaagccagaatggagaaggaactgttggagatgagacccttccggtcttct
tttcaggttcaacttgcctcgaaccctgtgctggatgcctggtacggtgctcgtgactgg
gccttgaaccacctagatgataatgaagtttggatcaccaggaaagagtatgaagaaaag
ggaggagagtacctcaaggagcactgtgcttccaacatctatgtccccatccgcctgccg
aagcaggcctcccgctcctcagatgcccaggcatccagcaagggctccgctgctggtgga
ggtggtgctggtgagcaggcatag

DBGET integrated database retrieval system