KEGG   Homo sapiens (human): 79929Help
Entry
79929             CDS       T01001                                 

Gene name
MAP6D1, MAPO6D1, SL21
Definition
(RefSeq) MAP6 domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 79929
NCBI-ProteinID: NP_079147
OMIM: 610593
HGNC: 25753
Ensembl: ENSG00000180834
Vega: OTTHUMG00000156900
Pharos: Q9H9H5(Tdark)
UniProt: Q9H9H5
Position
3q27.1
AA seq 199 aa AA seqDB search
MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDS
GRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPI
GDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKK
FTPNPSAIFQASAPRILNV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggccctgtatcagccgcctgtgctgcctggcgcggcgctggaaccagctggac
cgctccgacgtggcggtgccgctcactctgcacggctactcggacctcgacagcgaggag
ccgggcacgggcggcgccgcctcgcgcaggggccagcctcccgcgggcgcccgggattcc
ggccgggacgtgccgctcactcagtaccagcgggacttcggcttgtggaccacgcccgcc
gggcccaaggatccgccgccggggcgcggaccgggggcgggcggccgcaggggcaaatcc
tccgcgcagtcctccgcgccacctgcgcccggcgcccgcggggtctacgtgctgcccatc
ggcgacgcggacgcggctgcagcagtgaccacgtcgtacagacaggaattccaggcttgg
actggagtgaagccctcaagatccacaaagacaaaaccagcccgagtcatcacaacccac
acttcgggatgggacagcagccctggggccggcttccaggtcccagaggtgaggaagaag
ttcactcctaacccctccgccatctttcaggcctcagctccccggattctcaacgtgtga

DBGET integrated database retrieval system