KEGG   Homo sapiens (human): 79934Help
Entry
79934             CDS       T01001                                 

Gene name
COQ8B, ADCK4, NPHS9
Definition
(RefSeq) coenzyme Q8B
  KO
K08869  aarF domain-containing kinase
Organism
hsa  Homo sapiens (human)
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    79934 (COQ8B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  ABC1 family
   79934 (COQ8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC1
Motif
Other DBs
NCBI-GeneID: 79934
NCBI-ProteinID: NP_079152
OMIM: 615567
HGNC: 19041
Ensembl: ENSG00000123815
Vega: OTTHUMG00000182620
Pharos: Q96D53(Tbio)
UniProt: Q96D53
Position
19q13.2
AA seq 544 aa AA seqDB search
MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIR
RAREARPRKTPRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRL
QSEGGSGLDSSPFLSEANAERIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVR
QSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
PGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQL
LANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFE
FRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS
RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCP
PPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSW
VDPS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaaggtggggggcctacttcgggggaccggtggacagctgggccagactgtt
ggttggccttgtggggccctggggcctgggccccaccgctggggaccatgtggaggttct
tgggcccaaaagttttaccaggatgggcctgggagaggcctgggtgaggaggacattcgc
agggcacgggaggcccgtcccaggaagacaccccggccccagctgagtgaccgctctcga
gaacgcaaggtgcctgcctcccgcatcagccgcttggccaactttgggggactggctgtg
ggcttggggctaggagtactggccgagatggctaagaagtccatgccaggaggtcgtctg
cagtcagagggtggttctgggctggactccagccccttcctgtcggaggccaatgccgag
cggattgtgcagaccttatgtacagttcgaggggccgccctcaaggttggccagatgctc
agcatccaggacaacagcttcatcagccctcagctgcagcacatctttgagcgggtccgc
cagagcgccgacttcatgccccgctggcagatgctgagagttcttgaagaggagctcggc
agggactggcaggccaaggtggcctccttggaggaggtgccctttgccgctgcctcaatt
gggcaggtgcaccagggcctgctgagggacgggacggaggtggccgtgaagatccagtac
cccggcatagcccagagcattcagagcgatgtccagaacctgctggcggtactcaagatg
agcgcggccctgcccgcgggcctgtttgccgagcagagcctgcaggccttgcagcaggag
ctggcttgggagtgtgactaccgtcgtgaggcggcttgtgcccagaatttcaggcagctg
ctggcaaatgaccccttcttccgggtcccagccgtggttaaggagctgtgcacgacacgg
gtgctgggcatggagctggctggaggggtccccctggaccagtgccagggcctaagccag
gacctgcggaaccagatttgcttccagctcctgacgctgtgtctgcgggagctgtttgag
ttccgattcatgcagactgaccccaactgggccaacttcctgtatgatgcctccagccac
caggtgaccctgctggactttggtgcaagccgggagtttgggacagagttcacagaccat
tacatcgaggtggtgaaggctgcagctgatggagacagagactgtgtcctgcagaagtcc
agggacctcaaattcctcacaggctttgaaaccaaggcattctccgacgcccacgtggag
gcagtgatgatcctgggggagcctttcgccacccagggcccttatgactttgggtcgggg
gaaacggcccgccgcatacaggacctcatcccggtgctgctgcggcaccggctgtgtccc
ccacccgaggagacctatgccctgcaccgcaagctggcaggggctttcctggcctgtgcc
cacctccgagcccacatcgcctgcagggacctcttccaggacacctaccaccgctactgg
gccagtcgccagccagacgcagccactgccggcagcctccccaccaaaggggactcctgg
gtggatccctcatga

DBGET integrated database retrieval system