KEGG   Homo sapiens (human): 79937Help
Entry
79937             CDS       T01001                                 

Gene name
CNTNAP3, CASPR3, CNTNAP3A
Definition
(RefSeq) contactin associated protein like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C Laminin_G_3 EGF Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 79937
NCBI-ProteinID: NP_387504
OMIM: 610517
HGNC: 13834
Ensembl: ENSG00000106714
Vega: OTTHUMG00000019954
Pharos: Q9BZ76(Tdark)
UniProt: Q9BZ76
Position
9p12
AA seq 1288 aa AA seqDB search
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDAPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYRLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSYLDLNFEISFGGIPTPGRSRAFRRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELRRGSGSFV
LFLKDGKLKLSLFQPGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGGCLDNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGALGSFRDL
QIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGN
PSGLYYIDADGSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
AGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTSWGGSLPDAQ
KCTCGLEGNCIDSQYYCNCDAGRNEWTSDTIVLSQKEHLPVTQIVMTDAGRPHSEAAYTL
GPLLCRGDQSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFI
RIELRAPTEVTFSFDVGNGPCEVTVQSPTPFNDNQWHHVRAERNVKGASLQVDQLPQKMQ
PAPADGHVRLQLNSQLFIGGTATRQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAG
HCSTYGHLCRNGGRCREKRRGVTCDCAFSAYDGPFCSNEISAYFATGSSMTYHFQEHYTL
SENSSSLVSSLHRDVTLTREMITLSFRTTRTPSLLLYVSSFYEEYLSVILANNGSLQIRY
KLDRHQNPDAFTFDFKNMADGQLHQVKINREEAVVMVEVNQSTKKQVILSSGTEFNAVKS
LILGKVLEAAGADPDTRRAATSGFTGCLSAVRFGRAAPLKAALRPSGPSRVTVRGHVAPM
ARCAAGAASGSPARELAPRLAGGAGRSGPADEGEPLVNADRRDSAVIGGVIAVVIFILLC
ITAIAIRIYQQRKLRKENESKVSKKEEC
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtggcctgggccgtcctcaaggtgctgctgcttctccccactcagacttgg
agccccgtgggagcaggaaatccacctgactgtgatgccccactggcctctgccttgcct
aggtcatccttcagcagctcctcagagctgtccagcagccacggcccggggttttcaagg
cttaatcgaagagatggagctggtggctggactccacttgtgtcaaataaataccaatgg
ctgcaaattgaccttggagagagaatggaggtcactgctgtcgccacccaaggaggatat
gggagctctgactgggtgaccagctacctcctgatgttcagtgatggtgggagaaactgg
aagcagtatcgccgagaagaaagcatctggggttttccaggaaacacaaacgcagacagt
gtggtgcactacagactccagcctccctttgaagccaggttcctgcgctttctcccttta
gcctggaaccctaggggcaggattgggatgcggatcgaagtgtacggatgtgcatataaa
tctgaggtggtttattttgatggacaaagtgctctgctgtatagacttgataaaaaacct
ttaaaaccaataagagacgttatttctttgaaatttaaagccatgcagagcaatggaatt
ctacttcacagagaaggacaacatggaaatcacattactctggaattaattaaaggaaag
cttgtcttttttcttaattcaggcaatgctaagctgccttccactattgctcctgtgacc
ctcaccctgggcagcctgctggacgaccagcactggcattccgtcctcatcgagctcctc
gacacgcaggtcaacttcaccgtggacaaacacactcatcatttccaagcaaagggagat
tccagttacttggatcttaattttgagatcagctttgggggaattccgacacccggaaga
tcgcgggcattcagacgtaaaagctttcatgggtgtttagaaaatctttattataatgga
gtggatgttaccgaattagccaagaaacacaaaccacagatcctcatgatgggaaatgtg
tccttctcatgtccacagccacagactgtccctgtgacttttctgagctccaggagttat
ctggctctgccaggcaactctggggaggacaaagtgtctgtcacttttcaatttcgaacg
tggaacagagcaggacatttgcttttcggcgaacttcgacgtggttcagggagtttcgtc
ctctttcttaaggatggcaagctcaaactgagtctcttccagccgggacagtcaccaagg
aatgtcacagcaggtgctggattaaacgatgggcagtggcactctgtgtccttctctgcc
aagtggagccatatgaatgtggtggtggacgatgacacagctgttcagcccctggtggct
gtgctcattgattcaggtgacacctattattttggaggctgcctggacaacagctctggc
tctggatgtaaaagccccctgggagggtttcagggctgcctaaggctcatcaccattggt
gacaaagcggtggatcccatcttagtacagcagggggcgctggggagtttcagggacctc
cagatagactcctgcggcatcacagacaggtgcttgcccagctactgtgagcatgggggc
gagtgttcccagtcgtgggacaccttctcctgtgactgtctaggcacaggctatacgggc
gagacctgccattcctctctctacgagcagtcttgtgaagcccacaagcaccgagggaac
ccgtctgggctttactatattgatgcagatggaagtggccccctgggaccatttcttgtg
tactgcaatatgacagcagacgccgcgtggacggtggtgcagcacggtggccccgacgcg
gtgaccctccgaggtgcccccagcgggcacccgcgctcggctgtgtccttcgcgtacgca
gcgggcgcggggcagctgcggtccgcggtgaacctggcggagcgctgcgagcagcggctg
gctctgcgctgcgggacggcgcggcgcccggactcacgagatggaaccccactgagctgg
tgggttggaagaaccaatgaaacacacacttcctggggaggttctctgcctgatgctcaa
aagtgtacttgtggattagaggggaactgcattgattctcagtattactgcaactgtgat
gctggccggaatgaatggactagtgacacaatagtcctttcccaaaaggagcacctgcca
gtcactcagattgtgatgacagacgcaggccgaccacattccgaagcagcttatacactg
gggccactgctctgccgcggagatcagtcattctggaattcagcttccttcaacactgag
acttcataccttcatttccctgctttccacggagaactcactgctgacgtgtgcttcttt
tttaagaccacagtttcctccggggtgtttatggagaacctggggatcacagatttcatc
aggattgagctgcgtgctcccacagaagtgaccttttccttcgatgtggggaatggacct
tgtgaggtcacggtgcagtcacccactccctttaatgacaatcagtggcaccacgtgagg
gcagagagaaatgttaaaggagcgtctcttcaagttgatcagcttcctcagaagatgcag
cctgcccctgctgatgggcacgttcgtttacagctcaacagccagctcttcattggtgga
acggccaccagacagagaggctttctaggatgcattcggtctctgcagttgaacggggtg
gccctggatctggaagaaagagccacagtgacgccaggagtggagccagggtgtgcagga
cactgcagcacctatggacacttgtgtcgcaatggagggagatgcagagagaaacgcagg
ggggtcacctgtgactgtgccttctcagcctatgatgggccgttctgctccaatgagatt
tccgcatattttgcaactggctcctcaatgacataccattttcaagaacattacacttta
agtgaaaactccagctctctcgtttcttcattacacagagatgtaacattgaccagagaa
atgatcacactgagcttccgaaccacacgaactccgagcttattgctgtatgtgagctct
ttctatgaggaatacctttcagttatcctcgccaacaatggaagtttgcagattaggtac
aagctagatagacatcaaaatcctgatgcatttacctttgattttaaaaacatggctgat
gggcaacttcaccaagtgaagattaacagagaagaagctgtggtcatggtagaggttaac
cagagcacaaagaaacaagtcatcttgtcctcagggacagaattcaacgccgtcaaatct
ctcatattgggaaaggttttagaggctgccggcgcggacccggacacaaggcgggcggcg
actagtggcttcactggctgcctctcggcggtgcgcttcggccgcgctgctcccctgaag
gcggcgctgcgccccagcggcccctcccgggtcaccgtccgcggccacgtggcccctatg
gcccgctgcgcagcgggggcggcgtccggctccccggcgcgggaactggctccccgactc
gcggggggcgcaggtcgttctggaccagcggatgagggagagcccttggttaatgcagac
agaagagactctgctgtcatcggaggtgtgatagcagtggtgatatttattttgctttgc
atcactgccatagccatacgcatctatcaacagagaaagttacgcaaagaaaatgagtca
aaagtctcaaaaaaagaagagtgctag

DBGET integrated database retrieval system