KEGG   Homo sapiens (human): 79953
Entry
79953             CDS       T01001                                 
Symbol
SYNDIG1, C20orf39, DSPC2, IFITMD5, TMEM90B
Name
(RefSeq) synapse differentiation inducing 1
  KO
K23903  synapse differentiation-inducing gene protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79953 (SYNDIG1)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   79953 (SYNDIG1)
SSDB
Motif
Pfam: CD225
Other DBs
NCBI-GeneID: 79953
NCBI-ProteinID: NP_001310535
OMIM: 614311
HGNC: 15885
Ensembl: ENSG00000101463
Vega: OTTHUMG00000032104
Pharos: Q9H7V2(Tdark)
UniProt: Q9H7V2
Position
20:24469629..24666616
AA seq 258 aa
MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPA
SLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRS
PTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRD
HLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQASTSSRRALFLAVLSITIGTGV
YVGVAVALIAYLSKNNHL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggatggcatcattgaacagaagagcatgctggtgcacagtaaaatcagtgatgctggc
aagaggaatggtttaattaacaccagaaacttgatggccgagagcagagatggtctggtg
tctgtttacccagcgccccagtaccagagccaccgggtgggggccagcacagtgccggcc
agcctggacagcagcaggagtgagccgatgcagcagctgctggaccccaacaccctgcag
cagtcagtggagtcccgctaccggcccaacatcatcctctattcagagggcgtgctgcgc
tcctggggggacggtgtggccgccgactgctgcgagaccaccttcatcgaggaccggtcg
cccaccaaagacagcctcgagtacccggatgggaagttcattgacctctcagctgatgac
ataaaaatccacaccctgtcctacgatgtggaggaggaggaggagttccaggagctggag
agcgactactcaagcgacacagagagtgaggacaatttcctcatgatgcccccgcgggac
cacctgggcctcagtgtcttctccatgctctgctgcttctggcctctgggcatcgcagcc
ttctacttgtcccatgagaccaacaaagccgtggccaagggggacttgcaccaggccagc
accagctcccggcgggccctattcctggcagtgctgtccatcaccattgggactggcgtc
tatgtgggcgtggccgtggccctcatcgcctacctctccaagaacaaccacctgtga

DBGET integrated database retrieval system