KEGG   Homo sapiens (human): 79959Help
Entry
79959             CDS       T01001                                 

Gene name
CEP76, C18orf9, HsT1705
Definition
(RefSeq) centrosomal protein 76
  KO
K16457  centrosomal protein CEP76
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79959 (CEP76)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    79959 (CEP76)
   Centrosome duplication proteins
    Regulators of centriole replication
     79959 (CEP76)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CEP76-C2 Transglut_core Transglut_core3
Motif
Other DBs
NCBI-GeneID: 79959
NCBI-ProteinID: NP_079175
HGNC: 25727
Ensembl: ENSG00000101624
Vega: OTTHUMG00000131701
Pharos: Q8TAP6(Tdark)
UniProt: Q8TAP6 B4DP81
Position
18p11.21
AA seq 659 aa AA seqDB search
MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQHLSTEDLIKALRRRG
IIDDVMKELNFVTDSVEQELPSSPKQPICFDRQSTLKKTNIDPTRRYLYLQVLGGKAFLE
HLQEPEPLPGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMA
DSTTMLSISDPIHMVLIKTDIFGETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESK
VSVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWWREYLQIRPS
HNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYERAPVIGGGGKQ
EQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGVPHAWVMTCGTDGAI
TFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVF
DLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHR
KDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPIHF
VYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRSVL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcctccggagaaagcctccgagctgaagcagctcatccaccagcagctgagc
aagatggatgtccatggtagaataagagaaatccttgctgagactatacgggaagaattg
gcacctgatcaacagcatttatcaacagaagatttgatcaaagcccttagacgtcgagga
atcattgacgatgtgatgaaagaacttaattttgttactgacagtgttgagcaagaactc
ccttcctctccaaaacaacctatttgttttgatagacaatcgacattaaaaaaaactaat
attgatccaacacggaggtatctttaccttcaggttttgggtggaaaagctttcttggaa
catctgcaagaacctgagcctttacctggacaagtttgttcaacgtttactttatgttta
cattatcgaaaccaacgttttcgttctaaacctgttccatgtgcctgtgaaccagatttt
catgatggctttttacttgaagtacacagagaaagcttgggtgatggaactagaatggct
gattcaacaacaatgttatcaataagtgatccaattcatatggtgctaatcaaaacagac
atatttggtgagacgactttagtagcatcatattttctggaatggcgatcggttttgggc
tcagaaaatggagtgaccagtctgactgtggaacttatgggtgtaggcacagaatcaaaa
gtttctgtgggaattttaaatataaaacttgaaatgtatccaccactcaatcaaacgtta
tctcaagaagtagtgaacacacagcttgctttggaacgtcagaaaactgcagagaaagag
cgattatttcttgtatatgctaagcagtggtggagagaatatttgcaaattcgaccctca
cacaactcacgactggttaagatttttgcacaggatgaaaatgggataaatagaccagtc
tgttcctatgttaaaccacttcgagctggacggcttcttgatactccaaggcaagcagca
agatttgttaatgtccttggttatgaacgagcccctgttattggaggaggaggtaaacag
gagcagtggtgcactctgctggcctttctctgtagaaacaagggtgactgtgaagatcac
gctaaccttctgtgcagccttcttcttggatatggattagaagcctttgtttgtgttggg
accaaggcaaaaggagtacctcatgcatgggttatgacttgtggaactgatggggccatc
actttttgggagagtttaacaggacacaggtacatccataaacctaccaatcctgatgaa
cctccagttgctgaacagcccaaaccactgtacccatatcgaacaattggttgtgttttc
aaccatcagatgttcctgggaaattgtcaaccctctgatgcagtagaaacctgtgtattt
gatttgaacgatgaatccaaatggaaacccatgagtgaggaagcaattaaatctgtgtgt
gctcctggagctacaacatcccttcctccctttccacctctgtgtgcatccacaattgac
gcgtcagtaacaagtaatgaaattgaaatgcagctgaggctcctggtgtcagaacacagg
aaggatcttggcctcactactgtttgggaagaccagctctcctaccttttatcaccagct
ttggcttcttatgaatttgagcgtacaacaagtatatcagcaggcaatgaagaatttcaa
gatgccataagaagggctgtacctgatggtcacacatttaaagggttcccaatacatttt
gtgtatagaaatgcaagacgtgcatttgccacatgtcttcgatctcctttctgtgaagaa
ataatctgttgccgtggagaccaagtgcgactggcagttcgtgtccgagtatttacttac
cctgaatctgcatgtgctgtttggatcatgtttgcttgtaaatatcgctcggtattatag

DBGET integrated database retrieval system