KEGG   Homo sapiens (human): 79971Help
Entry
79971             CDS       T01001                                 

Gene name
WLS, C1orf139, EVI, GPR177, MRP, mig-14
Definition
(RefSeq) Wnt ligand secretion mediator
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MIG-14_Wnt-bd
Motif
Other DBs
NCBI-GeneID: 79971
NCBI-ProteinID: NP_079187
OMIM: 611514
HGNC: 30238
Ensembl: ENSG00000116729
Vega: OTTHUMG00000009153
Pharos: Q5T9L3(Tbio)
UniProt: Q5T9L3
Position
1p31.3
AA seq 541 aa AA seqDB search
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKT
KWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAF
KLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTF
LTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGM
WNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQ
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctggggcaattatagaaaacatgagcaccaagaagctgtgcattgttggtgggatt
ctgctcgtgttccaaatcatcgcctttctggtgggaggcttgattgctccagggcccaca
acggcagtgtcctacatgtcggtgaaatgtgtggatgcccgtaagaaccatcacaagaca
aaatggttcgtgccttggggacccaatcattgtgacaagatccgagacattgaagaggca
attccaagggaaattgaagccaatgacatcgtgttttctgttcacattcccctcccccac
atggagatgagtccttggttccaattcatgctgtttatcctgcagctggacattgccttc
aagctaaacaaccaaatcagagaaaatgcagaagtctccatggacgtttccctggcttac
cgtgatgacgcgtttgctgagtggactgaaatggcccatgaaagagtaccacggaaactc
aaatgcaccttcacatctcccaagactccagagcatgagggccgttactatgaatgtgat
gtccttcctttcatggaaattgggtctgtggcccataagttttaccttttaaacatccgg
ctgcctgtgaatgagaagaagaaaatcaatgtgggaattggggagataaaggatatccgg
ttggtggggatccaccaaaatggaggcttcaccaaggtgtggtttgccatgaagaccttc
cttacgcccagcatcttcatcattatggtgtggtattggaggaggatcaccatgatgtcc
cgacccccagtgcttctggaaaaagtcatctttgcccttgggatttccatgacctttatc
aatatcccagtggaatggttttccatcgggtttgactggacctggatgctgctgtttggt
gacatccgacagggcatcttctatgcgatgcttctgtccttctggatcatcttctgtggc
gagcacatgatggatcagcacgagcggaaccacatcgcagggtattggaagcaagtcgga
cccattgccgttggctccttctgcctcttcatatttgacatgtgtgagagaggggtacaa
ctcacgaatcccttctacagtatctggactacagacattggaacagagctggccatggcc
ttcatcatcgtggctggaatctgcctctgcctctacttcctgtttctatgcttcatggta
tttcaggtgtttcggaacatcagtgggaagcagtccagcctgccagctatgagcaaagtc
cggcggctacactatgaggggctaatttttaggttcaagttcctcatgcttatcaccttg
gcctgcgctgccatgactgtcatcttcttcatcgttagtcaggtaacggaaggccattgg
aaatggggcggcgtcacagtccaagtgaacagtgcctttttcacaggcatctatgggatg
tggaatctgtatgtctttgctctgatgttcttgtatgcaccatcccataaaaactatgga
gaagaccagtccaatggcgatctgggtgtccatagtggggaagaactccagctcaccacc
actatcacccatgtggacggacccactgagatctacaagttgacccgcaaggaggcccag
gagtag

DBGET integrated database retrieval system