KEGG   Homo sapiens (human): 79989
Entry
79989             CDS       T01001                                 
Symbol
TTC26, BRENS, DYF13, IFT56, dyf-13
Name
(RefSeq) tetratricopeptide repeat domain 26
  KO
K19685  intraflagellar transport protein 56
Organism
hsa  Homo sapiens (human)
Disease
H02547  BRENS syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    79989 (TTC26)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   79989 (TTC26)
SSDB
Motif
Pfam: TPR_19 ANAPC3 TPR_2 TPR_14 TPR_8 TPR_16 TPR_9 TPR_1 TPR_12 TPR_17 Coatomer_E TPR_11 TPR_6 zf-UBP
Other DBs
NCBI-GeneID: 79989
NCBI-ProteinID: NP_079202
OMIM: 617453
HGNC: 21882
Ensembl: ENSG00000105948
Pharos: A0AVF1(Tdark)
UniProt: A0AVF1
Position
7:139133778..139191986
AA seq 554 aa
MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTN
LWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKS
RLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLD
NREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEA
ELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDD
VQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIP
GRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQ
SEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYS
AKAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMI
RIMKKWAKENRVSI
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgatgctttcaagggccaaacctgctgtaggcagaggcgtacagcacactgacaaaaga
aagaagaaaggtaggaagattccaaaactagaggagctactttcaaaaagagatttcact
ggagctattaccctgttggagttcaaacgtcatgttggggaagaagaagaggatactaat
ttgtggattggatattgtgcctttcacctgggtgactacaagagagctctggaggaatac
gaaaatgctacaaaagaggaaaattgtaattctgaagtctgggtgaacctagcttgcacc
tacttctttcttgggatgtataaacaagctgaagcagctggatttaaagcttcaaaaagc
cgactccaaaaccgcctcctcttccacttggctcacaagtttaatgatgagaaaaaattg
atgagctttcatcaaaatcttcaggatgtcacagaagatcaactcagtttggcctcaatc
cactatatgcgatctcactaccaagaagctatagatatatataagcgaatactgctagat
aacagggaataccttgcccttaatgtttatgtggccctctgctactacaagttggattac
tatgatgtgtctcaagaagttttggctgtttaccttcagcaaattcctgatagtaccatc
gcactcaatcttaaagcctgtaaccattttcgcctttacaatggcagagcagctgaggca
gaactcaaaagcttgatggacaatgcttcttcatcctttgaatttgctaaagaactcatc
aggcacaatctggttgttttccgaggaggtgaaggggctttgcaggttttacctccccta
gttgatgtcattcctgaagctaggctaaacttggtgatttactaccttcgtcaagatgat
gtacaagaagcttataacttaattaaggatctggaacctactactcctcaggagtatatt
ctcaaaggagtggtcaatgcagcccttggccaggaaatgggttcaagggatcatatgaaa
attgcccagcagttcttccagttggtgggaggatcagctagtgaatgtgatacaatacca
gggaggcagtgcatggcttcctgtttcttcctgcttaagcaatttgatgatgttttgatt
tacctcaactcatttaagagttacttctataatgatgacatctttaactttaattatgcc
caagccaaagctgcaacaggcaataccagtgagggcgaagaggcgttcctcttgatccaa
agtgagaagatgaaaaatgattacatttacctcagctggttagctcggtgctatattatg
aataagaaaccaagactagcctgggaactttatcttaagatggaaacctccggcgagtcc
ttcagtctcttacagctcattgctaatgactgctacaagatgggccagttttactattct
gccaaagcttttgatgtccttgagaggctggatcctaaccctgaatattgggaaggcaaa
cggggtgcctgtgtgggcattttccagatgatcatagctgggagagaacccaaagagacc
cttcgagaagtgctccatttactgagaagcacaggtaacacccaagtagaatacatgatc
cggatcatgaagaaatgggccaaagaaaacagagtgtccatctaa

DBGET integrated database retrieval system