KEGG   Homo sapiens (human): 8000Help
Entry
8000              CDS       T01001                                 

Gene name
PSCA, PRO232
Definition
(RefSeq) prostate stem cell antigen
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP Activin_recp
Motif
Other DBs
NCBI-GeneID: 8000
NCBI-ProteinID: NP_005663
OMIM: 602470
HGNC: 9500
Ensembl: ENSG00000167653
Vega: OTTHUMG00000162077
UniProt: O43653 D3DWI6
Position
8q24.3
AA seq 114 aa AA seqDB search
MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLN
CVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcttggccctgcagccaggcactgccctgctgtgctactcctgcaaagcccag
gtgagcaacgaggactgcctgcaggtggagaactgcacccagctgggggagcagtgctgg
accgcgcgcatccgcgcagttggcctcctgaccgtcatcagcaaaggctgcagcttgaac
tgcgtggatgactcacaggactactacgtgggcaagaagaacatcacgtgctgtgacacc
gacttgtgcaacgccagcggggcccatgccctgcagccggctgctgccatccttgcgctg
ctccctgcactcggcctgctgctctggggacccggccagctctag

DBGET integrated database retrieval system