KEGG   Homo sapiens (human): 80006
Entry
80006             CDS       T01001                                 
Symbol
TRAPPC13, C5orf44, SHLD3
Name
(RefSeq) trafficking protein particle complex subunit 13
  KO
K20310  trafficking protein particle complex subunit 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80006 (TRAPPC13)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    80006 (TRAPPC13)
SSDB
Motif
Pfam: DUF974 Trs65 Transglut_C
Other DBs
NCBI-GeneID: 80006
NCBI-ProteinID: NP_079217
HGNC: 25828
Ensembl: ENSG00000113597
UniProt: A5PLN9
Position
5:65625027..65666233
AA seq 417 aa
MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLM
LGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVA
ELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYN
AESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSR
AYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMA
PGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLG
KLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggaagtgaatccccctaaacaggagcacctgctggcgctaaaagtgatgcggctgact
aagcctactttattcaccaatatcccagtaacatgtgaagagaaagacttacctggagat
ctctttaaccagctgatgagagatgatccttcaaccgttaatggtgcagaagttttaatg
ttgggagaaatgctgactttaccacagaattttgggaatatatttttgggagagaccttt
tccagttatatcagcgttcataatgatagcaatcaagttgtaaaagacatattagtaaaa
gctgatcttcagacaagttctcagcgtttaaatctttcagcctccaatgctgcagtggct
gaacttaaaccggattgttgtattgatgatgtcatacatcatgaagtcaaagaaattgga
acacacatcttggtatgtgctgtgagttatacaactcaggctggagaaaaaatgtatttc
agaaaattcttcaaatttcaggttctcaaaccattggatgtgaaaaccaaattttacaat
gcagagagtgacctcagttctgtgactgatgaagtatttctggaagcccagattcagaat
atgacaacctcacctatgtttatggagaaggtttcactggagccatctattatgtacaat
gtaacagaattaaattcagtcagccaagctggagaatgtgtgtctacgtttgggtcaaga
gcatatttgcaaccaatggatacacgccagtacttatactgcctaaagccaaagaatgaa
tttgcagaaaaagcaggcatcattaagggagtaacagtaattggaaaattggatatagta
tggaaaacaaatctaggtgaaaggggaaggttacagaccagccaacttcaaagaatggct
ccaggttatggagatgttaggttgtctttggaggcaataccagataccgtaaaccttgaa
gaaccttttcatattacctgtaaaataacaaactgcagtgaaaggactatggatctggtt
ttggaaatgtgcaataccaattccatccactggtgtggaatttcaggaagacagctggga
aagctgcatccaagttcttcgctctgtcttgcccttactctgctttcttcagtacaggga
ctgcaaagcatctctggcttaagactaacagacacattcttaaagagaacatatgaatat
gatgacatcgcacaagtctgtgtggtatcttctgccattaaagtggaaagctga

DBGET integrated database retrieval system