KEGG   Homo sapiens (human): 80008
Entry
80008             CDS       T01001                                 
Symbol
TMEM156
Name
(RefSeq) transmembrane protein 156
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TMEM156 IgaA HemY_N
Other DBs
NCBI-GeneID: 80008
NCBI-ProteinID: NP_079219
HGNC: 26260
Ensembl: ENSG00000121895
UniProt: Q8N614
Position
4:complement(38966744..39032409)
AA seq 296 aa
MTKTALLKLFVAIVITFILILPEYFKTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTF
LQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCESKGNMDFISQEQTSKV
LIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKS
INYTCRIMEYPNDCIHISLHLEMDIKNITCSMKITWYILVLLVFIFLIILTIRKILEGQR
RVQKWQSHRDKPTSVLLRGSDSEKLRALNVQVLSAETTQRLPLDQVQEVLPPIPEL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgacaaaaacagccctccttaaattatttgtggcaatagtgatcacattcattttaatt
ttgccggaatatttcaagacaccgaaagaaagaacattggagctatcatgtctggaagtg
tgtttgcaatctaattttacctattcactctcctccttaaatttttcttttgtgactttt
ctgcaaccagtaagggaaactcagattatcatgagaatctttctaaatccctccaatttt
cgtaacttcaccaggacttgccaagacatcacaggtgaatttaaaatgtgctcctcgtgt
ttggtttgtgagtctaaaggaaacatggattttatttctcaggaacaaacatcaaaagtt
cttatcaggagaggatcaatggaagtgaaagcaaatgattttcattcaccttgtcagcac
tttaacttcagtgtagctcctctggttgaccacttggaggaatataacactacctgtcat
ctaaaaaaccacactggaagatcaacaatcatggaggatgagccaagcaaggagaaatcg
ataaactacacttgtagaatcatggaatacccgaatgattgtatacacatttctttgcac
ctagagatggatataaaaaatatcacttgttccatgaagatcacttggtatattttagtt
ctattagtttttatatttttgatcatcctcactatccgcaaaatacttgaaggccagaga
agagtgcaaaagtggcagagtcatagagacaaacctacatctgttctcttaagaggaagt
gattcggagaaactgagagcattgaatgtgcaggttctttcagcagagaccacgcagagg
ctgcctttggatcaagtccaggaagtgcttcccccaattccagaactataa

DBGET integrated database retrieval system