KEGG   Homo sapiens (human): 80010Help
Entry
80010             CDS       T01001                                 

Gene name
RMI1, BLAP75, C9orf76, FAAP75
Definition
(RefSeq) RecQ mediated genome instability 1
  KO
K10990  RecQ-mediated genome instability protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    80010 (RMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    80010 (RMI1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     80010 (RMI1)
   FA (Fanconi anemia) pathway
     80010 (RMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RMI1_N RMI1_C Rbx_binding
Motif
Other DBs
NCBI-GeneID: 80010
NCBI-ProteinID: NP_079221
OMIM: 610404
HGNC: 25764
Ensembl: ENSG00000178966
Vega: OTTHUMG00000020113
Pharos: Q9H9A7(Tbio)
UniProt: Q9H9A7
Structure
PDB: 

Position
9q21.32
AA seq 625 aa AA seqDB search
MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTD
LRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
QVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVL
LLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPAL
GPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPS
NLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTN
NFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKN
LETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINL
SIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAY
LDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSL
SKAMVLALQDVNMEHLENLKKRLNK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgactagtattgcattaagagctgaaacttggcttttagctgcatggcatgtt
aaagtacctccgatgtggctggaagcttgtattaactggattcaagaagaaaataataat
gttaacttgagtcaggcccaaatgaataaacaagtgtttgagcagtggctccttactgat
ctgagggatttggagcatcctcttttacccgatggcattttagaaattccaaaaggagaa
ttaaatggattttatgctctgcagattaattccttggttgatgtaagtcagcctgcatac
tcccagatacagaagttgagaggaaagaatacaacaaatgatctagttacagctgaagca
caagtaaccccaaaaccttgggaagcaaagccttcacgaatgttgatgctgcagctaact
gatggaatcgtacaaatacagggaatggaatatcagcctattccaattcttcatagtgat
cttcctccaggtacaaaaattttgatttatggaaatatatctttccgtcttggtgttctc
ttattgaaaccagaaaacgtgaaagtgttaggaggtgaagtagatgctcttttagaagaa
tatgcccaagaaaaagtacttgcaagattaataggggaacctgatcttgtagtttcagtc
ataccaaacaattctaacgaaaacattcccagagttacagatgttctagatcctgcatta
ggtccttctgatgaagaactcttggcaagtcttgatgaaaatgatgagcttacagcaaat
aatgacacttcctcagaacgatgtttcaccacaggtagttcctcaaataccattcccaca
agacagtcaagttttgagccagaatttgttatttctccaagaccaaaagaggaaccatca
aacctatctatacatgtaatggatggagaattagatgacttttcactggaggaggccttg
cttttagaagaaactgtccagaaagaacagatggaaactaaggaattgcaaccattgact
tttaacagaaatgccgatcgaagtatagagagattttcacataatcctaatactacgaat
aacttttctttgacttgcaaaaatggaaacaataattggagtgaaaaaaatgtatctgaa
caaatgactaatgaagacaaatcatttggttgtccatctgttagagaccaaaacaggagt
attttttcagttcattgtaatgtacccttagcccatgattttacaaataaagaaaagaac
ttagagacagataataaaataaaacaaaccagcagttcagatagccattccttaaataat
aaaatattaaatagagaggtggtcaactatgtacagaaaaggaattcacaaatttctaat
gaaaatgattgtaatttacagagttgttctttaagatcatcagagaatagcattaatctt
tctattgccatggatttgtattctccaccctttgtctatttgtctgttctaatggccagc
aaaccaaaggaagttacaacagtgaaagtgaaagcatttattgtaaccttaactggaaat
ctctcaagttctggtggtatttggagtataactgcaaaggtgtctgatggtactgcatat
ctagatgtagactttgtggatgaaatacttactagcttgatagggttctcagtaccagaa
atgaaacagtcaaaaaaggatcctcttcaataccaaaagttcctggaagggttgcagaaa
tgtcaaagagatctaatagatttgtgctgtctaatgactatttcatttaatccttccttg
tctaaagcaatggtactggcattacaagatgttaatatggaacaccttgagaatctaaag
aagcggttaaataaataa

DBGET integrated database retrieval system