KEGG   Homo sapiens (human): 80013
Entry
80013             CDS       T01001                                 

Gene name
MINDY3, C10orf97, CARP, DERP5, FAM188A, MST126, MSTP126, my042
Definition
(RefSeq) MINDY lysine 48 deubiquitinase 3
  KO
K22647  ubiquitin carboxyl-terminal hydrolase MINDY-3/4 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80013 (MINDY3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     80013 (MINDY3)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MINDY
    80013 (MINDY3)
SSDB
Motif
Pfam: DUF4205 EF-hand_7
Other DBs
NCBI-GeneID: 80013
NCBI-ProteinID: NP_079224
OMIM: 611649
HGNC: 23578
Ensembl: ENSG00000148481
Vega: OTTHUMG00000017734
Pharos: Q9H8M7(Tdark)
UniProt: Q9H8M7
Position
10p13
AA seq 445 aa
MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAF
LLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETA
SISGSPAESSCQVEHSSALAVEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFG
VLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDREC
SGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVA
PEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIIL
LGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP
IKRCLQTKWPYIELLWTTDRSPSLN
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtccgaactgactaaagagctgatggagctggtgtggggcaccaagagcagccccggt
ctctcggacaccattttctgccgctggacgcaagggtttgtgtttagtgaatcagaggga
tctgcattagaacagtttgaaggtggcccctgtgctgttattgcacctgttcaggcattt
cttttgaagaagctcctgttttcttcggagaagtcttcttggcgggattgttcagaggaa
gagcagaaggaactcctttgtcataccttgtgtgatattttagaaagtgcttgttgtgac
cactctggatcatactgcttggtttcatggttaagaggaaagacaactgaggaaactgct
agtatttctgggagtcctgcagagtctagttgccaagtggaacattcttctgccttggct
gtcgaagagcttggctttgagcgatttcatgcattaattcaaaaaagatcgttcagaagt
ttaccagaattaaaagatgctgtcttggaccagtattcaatgtggggaaataaatttgga
gtattgctttttctgtattctgtattactgacaaagggcattgaaaacataaaaaacgaa
attgaagatgcaagtgaacccttgatagatcctgtatatggacatggcagccaaagttta
attaatctcctgctgacgggacatgctgtttctaatgtatgggatggtgatagagagtgc
tcaggaatgaaacttcttggtatacatgaacaagcagcagtaggatttttaacactaatg
gaagctttaagatactgtaaggttggttcttacttgaaatctccaaaattccctatttgg
attgttggcagtgagactcacctcaccgtattttttgccaaggatatggctttagttgcc
cctgaagctccttcagaacaagccagaagagtttttcaaacctacgacccagaagataat
ggattcatacccgattcacttctggaagatgtgatgaaagcattggaccttgtttcagat
cctgaatatataaatctcatgaagaataaattagatccagaaggattaggaatcatatta
ttgggcccatttcttcaagaattttttcctgatcagggctccagtggtccagaatctttt
actgtctaccactacaatggattgaagcagtcaaattataatgaaaaggtcatgtacgta
gaagggactgcagttgtgatgggttttgaagatcccatgctacagacagatgacactcct
attaaacgctgtctgcaaaccaaatggccatacattgagttactctggaccacagatcgc
tctccttcactaaattaa

DBGET integrated database retrieval system