KEGG   Homo sapiens (human): 80018
Entry
80018             CDS       T01001                                 
Symbol
NAA25, C12orf30, MDM20, NAP1
Name
(RefSeq) N-alpha-acetyltransferase 25, NatB auxiliary subunit
  KO
K17973  N-terminal acetyltransferase B complex non-catalytic subunit
Organism
hsa  Homo sapiens (human)
Disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    80018 (NAA25)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    80018 (NAA25)
SSDB
Motif
Pfam: NatB_MDM20 TPR_19 BTAD
Other DBs
NCBI-GeneID: 80018
NCBI-ProteinID: NP_079229
OMIM: 612755
HGNC: 25783
Ensembl: ENSG00000111300
Vega: OTTHUMG00000169638
Pharos: Q14CX7(Tbio)
UniProt: Q14CX7
Structure
Position
12:complement(112026689..112108783)
AA seq 972 aa
MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGK
QEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLF
MAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERM
VEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYK
KLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVHYSAE
KAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFG
DKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQL
TRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWR
ETGDETTVWQALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHD
TIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFR
NRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWEDLRDNRDLNV
FFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHPVEPKNSEKTAENGV
SSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLV
NDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLEN
LVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTL
ISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELL
KKRLETTKKLKI
NT seq 2919 nt   +upstreamnt  +downstreamnt
atggcgacgcggggccatgtgcaggaccctaacgacaggcgcctccggcccatttacgat
tatcttgacaatggtaataataaaatggcaattcagcaagcagataaactgttgaagaaa
cataaggatcttcattgtgctaaggttttaaaggcaattggtttacagagaactggaaag
caagaggaagcctttactcttgcacaggaggtggcagcccttgaacccacagatgacaac
tcactgcaggcactgactatcctttaccgggagatgcaccgaccggagttagttacaaaa
ctttatgaggcagctgtgaagaaagttcccaatagtgaggagtatcactctcacctcttc
atggcctatgccagagtgggtgaatacaagaaaatgcaacaggctggcatggctctatat
aagattgtccccaaaaatccctactacttttggtctgtgatgagcttaattatgcaatct
atatcggcacaggatgaaaacctctcaaaaacaatgtttctgccccttgctgagagaatg
gtcgaaaaaatggtgaaagaggacaagatagaagctgaggctgaagttgaactttattat
atgatcctggaacgtttgggaaagtaccaggaggccttggatgtcatcagagggaaatta
ggagagaagttgacaagtgagattcagagtcgggaaaataaatgcatggctatgtacaag
aagctgagcaggtggccagagtgcaatgccctttcccggcgcctcttactaaaaaactca
gatgactggcagttctatctgacttatttcgattctgtctttcgactgattgaagaggcc
tggagtcctcctgctgaaggtgaacactctttagaaggagaagtacattattctgcagaa
aaagctgtgaagtttatagaagatcggataacggaagaatctaaaagttctcgccatctc
cgaggaccacatctagctaaattggagctgattaggcgtttacgaagtcaaggttgtaac
gatgagtacaaactgggtgatccagaagaattaatgttccagtattttaaaaagtttggc
gataaaccttgttgttttacagaccttaaggtgtttgttgacctcttacctgctacacag
tgtacaaaatttattaatcagttacttggagttgttcctttgtcgacaccaacagaggat
aagctggcactgcctgctgacatcagagctctgcagcaacatttgtgtgtggtgcagctg
acgaggttacttggcttgtaccacaccatggataaaaatcagaaattgagtgtggtcaga
gaattgatgttaaggtaccagcatggactggaatttgggaaaacctgtttgaaaacagaa
ttgcaattttctgactattactgtctccttgctgtccatgcgcttattgatgtatggagg
gaaacaggtgatgagaccactgtgtggcaggccctgactttgctggaagagggattaacc
catagcccttccaatgctcagttcaaattgctgcttgttcgaatctactgtatgctgggt
gcatttgaaccagtggtggatctttactccagcctcgatgctaagcatatccagcatgat
accattggttatcttttgacccgatatgctgaatctctaggtcagtatgctgctgcgtcc
caatcctgtaacttcgcactcaggttttttcactccaaccagaaagatacctcagaatat
attattcaagcttacaaatatggtgcatttgagaagatcccagagtttatcgcttttagg
aacaggctgaataattctcttcattttgcacaagtccgtactgaacggatgctgttagac
cttctacttgaagcaaatatatcaaccagtttagcagaaagtataaagtcaatgaacctt
aggccagaagaagatgacattccatgggaagatttgcgagacaacagagacttaaatgtt
tttttcagctgggatccaaaagacagggacgtttctgaagaacataagaaactttcctta
gaggaggagaccttgtggttaagaatccgatccttaacattgaggctgataagtggactt
ccaagtctcaaccaccctgtggagccaaagaactcggagaagactgccgagaatggggta
tcctcccggattgatattcttcgtttgctccttcaacagctggaggcaaccctggagaca
ggaaagcgatttattgagaaggatattcagtatcctttccttggtcctgtacctaccaga
atgggtggattctttaattctggctgttctcagtgccagataagctctttttatcttgtc
aatgatatttatgagctggataccagtggtttagaggatacaatggagattcaggaacga
atagaaaatagttttaagtctttactagaccagttaaaagatgtcttcagtaaatgtaaa
ggtgacctcttagaagttaaagatggtaacttgaaaacacatcctactcttttagaaaat
ctagttttctttgttgagactatttctgttatcctttgggtatccagttactgtgagagt
gtcctacgaccatacaaactaaatttacagaaaaagaaaaagaagaaaaaagaaaccagc
atcatcatgccacctgtctttaccagtttccaagactatgttactgggcttcagacttta
atttccaatgttgtggatcatattaaagggcttgaaacacatctaattgcacttaaactt
gaagaacttattttagaagacacttctctctcaccggaagagagaaaattttcaaagact
gtgcaagggaaggtgcagagcagttatctgcactcacttctggaaatgggggagctgctg
aaaaaaagacttgagaccacaaagaaactaaaaatttaa

DBGET integrated database retrieval system