KEGG   Homo sapiens (human): 80019Help
Entry
80019             CDS       T01001                                 

Gene name
UBTD1
Definition
(RefSeq) ubiquitin domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UBD ubiquitin Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 80019
NCBI-ProteinID: NP_079230
OMIM: 616388
HGNC: 25683
Ensembl: ENSG00000165886
Vega: OTTHUMG00000018856
Pharos: Q9HAC8(Tdark)
UniProt: Q9HAC8
Position
10q24.1-q24.2
AA seq 227 aa AA seqDB search
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactgcgtggggagacagcgccgggagaggccggcagccccgggacacccccgc
aagcgagcaggacgcaatgagcccctgaagaaagagcggcttaagtggaagagcgactac
cccatgactgacgggcagctgcggagcaaacgggatgagttctgggacacagcgcctgcc
ttcgagggccgcaaggagatctgggatgccctcaaggctgccgcctatgctgctgaagcc
aacgaccacgagctggcccaggccatcctggatggagccagcatcaccctgcctcatggc
accctctgtgaatgctacgatgagctgggcaatcgctaccagctgcccatctactgcctg
tcaccgccggtgaacctgctgctggagcacacggaggaggagagcctggagccccccgag
cctccacccagcgtgcgccgtgagttcccgctgaaggtgcgcctgtccacgggcaaggac
gtgaggctcagcgccagcctgcccgacacagtggggcagctcaagaggcagctgcacgcc
caggagggcatcgagccatcgtggcagcggtggttcttctccgggaagctgctcacagac
cgcacacggctccaggagaccaagatccagaaagattttgtcatccaggtcatcatcaac
cagcccccaccaccccaggactga

DBGET integrated database retrieval system