KEGG   Homo sapiens (human): 80020Help
Entry
80020             CDS       T01001                                 

Gene name
FOXRED2, ERFAD
Definition
(RefSeq) FAD dependent oxidoreductase domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 NAD_binding_8 DAO HI0933_like Pyr_redox K_oxygenase FMO-like FAD_binding_3 FAD_binding_2 Thi4
Motif
Other DBs
NCBI-GeneID: 80020
NCBI-ProteinID: NP_001095841
OMIM: 613777
HGNC: 26264
Ensembl: ENSG00000100350
Vega: OTTHUMG00000044614
Pharos: Q8IWF2(Tdark)
UniProt: Q8IWF2
Position
22q12.3
AA seq 684 aa AA seqDB search
MGLSAAAPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFE
RAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFP
DARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLFV
ATGLSVPNQVDFPGSEYAEGYESVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIH
MLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAILKDSKGKFHVTP
KFFLEEANTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNKSLRLNSGNAF
GKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSV
TWPATELPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQL
ETLTGRKAKHGLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRYLP
TEQEVRFRPAHWPLPRPTAIHHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAES
CFLFALTRQKLPPFCQQGYLRMQGLVSTESLWQHRVESRLLRDYAPTGRRLEDSSQQLGD
QEPLGSPLAPGPLAQSVDSNKEEL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccgctgcggccccgttgtggggtcccccggggctgctcctggccatcgcc
ctgcacccagcgctgtcggtgcccccgcgccgggactactgcgtgctgggcgctgggccc
gcgggcctgcagatggcctacttcctgcagcgcgctggacgcgactacgcagtgttcgag
cgggccccgcggcccggcagcttcttcacacgctacccgcggcaccgcaagctcatcagc
atcaacaagcggtacacgggcaaggctaacgccgagttcaacctccgccacgactggaac
tctctgctcagccacgacccccggctgctcttcagacactactcgcgtgcctacttcccc
gacgcccgcgacatggtgcgctacctgggtgacttcgcggacacgctggggctccgtgtc
cagtacaacaccaccatcgcccacgtcactctggacaaggaccgacaggcctggaatggc
cactacttcatcctaactgaccagaagggccaggtgcatcagtgcagcgtcctctttgta
gccactggtttatcagtccccaaccaggttgacttccctggctccgaatatgcagagggt
tacgagtccgtgtccgtggaccctgaggactttgtaggccagaatgtgctgatcctgggt
cgtgggaactcggcctttgagacagcagagaacatcttgggtgtcacaaactttatccat
atgctcagccgctcccgggtccgtctgtcctgggccacccactacgttggagacctcaga
gccatcaacaatggcctgctggatacctaccagctcaagtccctggacgggctgctcgag
tctgacctgacggatctggccatcctgaaggacagcaaaggcaagttccatgtcaccccg
aaattcttcctggaagaagccaacaccaaccagagtgccgactccatcaccctcccccag
gacgacaatgacaactttgccatgcgcgtgccctatgaccgggtaatccgctgcctgggc
tggaactttgacttctccattttcaataagtccctcagacttaactcgggaaatgcattc
ggcaagaagtacccgctgattcgagctagctacgaatccaaaggaagccggggtctgttt
atcctgggtactgccagccactcggtggactaccggaaatctgctgggggcttcatccac
ggattccgatacacagtgcgtgctgttcaccggctcctggagcaccgccaccacagcgtc
acctggcccgccactgagctccccatcacacagctgaccagctccatcgtgcggcgcgtg
aatgaggcttctgggctctaccagatgttcggtgtgctggccgatgtcatcctgttgaag
gagaattccacggcctttgagtacctggaggagttccccatacagatgctggcccagctg
gagacactcacagggaggaaggcaaagcacgggctcttcgtcatcaacatggaatatggc
agaaatttctctggccccgacaaggacgtcttctttgatgaccggtctgtggggcacaca
gaagatgcctggcagtctaactttcttcatcctgtcatctactactatagatacctcccc
accgaacaggaggtgaggttccgccctgcacactggcccctgcctcggcccacggccatc
catcacatcgtggaagacttcttaacagactggactgccccgatcgggcacatcctacct
ctgaggcgcttcctggagaactgtttggacaccgatttgcgaagcttctatgcagagtcc
tgcttcctgttcgccctcacgcgccagaagttgccacccttttgccagcaggggtacctg
aggatgcagggactcgtgagtaccgagagcctttggcagcacagagtggagagcaggctc
ctgcgggactatgcccccacaggcaggcgcctggaggacagcagccagcagcttggcgac
caagagccactaggttcccccctggctccagggcctctggctcagtccgtcgatagcaac
aaagaggagctctga

DBGET integrated database retrieval system