KEGG   Homo sapiens (human): 80070Help
Entry
80070             CDS       T01001                                 

Gene name
ADAMTS20, ADAM-TS20, ADAMTS-20, GON-1
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 20
  KO
K09609  a disintegrin and metalloproteinase with thrombospondin motifs 20 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    80070 (ADAMTS20)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     80070 (ADAMTS20)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   80070 (ADAMTS20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GON TSP_1 Pep_M12B_propep ADAM_spacer1 Reprolysin ADAM_CR_2 Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10
Motif
Other DBs
NCBI-GeneID: 80070
NCBI-ProteinID: NP_079279
OMIM: 611681
HGNC: 17178
Ensembl: ENSG00000173157
Vega: OTTHUMG00000169353
Pharos: P59510(Tbio)
UniProt: P59510
Position
12q12
AA seq 1910 aa AA seqDB search
MWVAKWLTGLLYHLSLFITRSWEVDFHPRQEALVRTLTSYEVVIPERVNEFGEVFPQSHH
FSRQKRSSEALEPMPFRTHYRFTAYGQLFQLNLTADASFLAAGYTEVHLGTPERGAWESD
AGPSDLRHCFYRGQVNSQEDYKAVVSLCGGLTGTFKGQNGEYFLEPIMKADGNEYEDGHN
KPHLIYRQDLNNSFLQTLKYCSVSESQIKETSLPFHTYSNMNEDLNVMKERVLGHTSKNV
PLKDERRHSRKKRLISYPRYIEIMVTADAKVVSAHGSNLQNYILTLMSIVATIYKDPSIG
NLIHIVVVKLVMIHREEEGPVINFDGATTLKNFCSWQQTQNDLDDVHPSHHDTAVLITRE
DICSSKEKCNMLGLSYLGTICDPLQSCFINEEKGLISAFTIAHELGHTLGVQHDDNPRCK
EMKVTKYHVMAPALSFHMSPWSWSNCSRKYVTEFLDTGYGECLLDKPDEEIYNLPSELPG
SRYDGNKQCELAFGPGSQMCPHINICMHLWCTSTEKLHKGCFTQHVPPADGTDCGPGMHC
RHGLCVNKETETRPVNGEWGPWEPYSSCSRTCGGGIESATRRCNRPEPRNGGNYCVGRRM
KFRSCNTDSCPKGTQDFREKQCSDFNGKHLDISGIPSNVRWLPRYSGIGTKDRCKLYCQV
AGTNYFYLLKDMVEDGTPCGTETHDICVQGQCMAAGCDHVLNSSAKIDKCGVCGGDNSSC
KTITGVFNSSHYGYNVVVKIPAGATNVDIRQYSYSGQPDDSYLALSDAEGNFLFNGNFLL
STSKKEINVQGTRTVIEYSGSNNAVERINSTNRQEKELILQVLCVGNLYNPDVHYSFNIP
LEERSDMFTWDPYGPWEGCTKMCQGLQRRNITCIHKSDHSVVSDKECDHLPLPSFVTQSC
NTDCELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTQEL
CHGNCVFTRWHYSEWSQCSRSCGGGERSRESYCMNNFGHRLADNECQELSRVTRENCNEF
SCPSWAASEWSECLVTCGKGTKQRQVWCQLNVDHLSDGFCNSSTKPESLSPCELHTCASW
QVGPWGPCTTTCGHGYQMRDVKCVNELASAVLEDTECHEASRPSDRQSCVLTPCSFISKL
ETALLPTVLIKKMAQWRHGSWTPCSVSCGRGTQARYVSCRDALDRIADESYCAHLPRPAE
IWDCFTPCGEWQAGDWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECSL
AACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTGPWGSCSSSC
SGGLQHRAVVCQDENGQSASYCDAASKPPELQQCGPGPCPQWNYGNWGECSQTCGGGIKS
RLVICQFPNGQILEDHNCEIVNKPPSVIQCHMHACPADVSWHQEPWTSCSASCGKGRKYR
EVFCIDQFQRKLEDTNCSQVQKPPTHKACRSVRCPSWKANSWNECSVTCGSGVQQRDVYC
RLKGVGQVVEEMCDQSTRPCSQRRCWSQDCVQHKGMERGRLNCSTSCERKDSHQRMECTD
NQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANNCGFSYRQRITYCTEIPS
TKKHKLHRLRPIVYQECPVVPSSQVYQCINSCLHLATWKVGKWSKCSVTCGIGIMKRQVK
CITKHGLSSDLCLNHLKPGAQKKCYANDCKSFTTCKEIQVKNHIRKDGDYYLNIKGRIIK
IYCADMYLENPKEYLTLVQGEENFSEVYGFRLKNPYQCPFNGSRREDCECDNGHLAAGYT
VFSKIRIDLTSMQIKTTDLLFSKTIFGNAVPFATAGDCYSAFRCPQGQFSINLSGTGMKI
SSTAKWLTQGSYTSVSIRRSEDGTRFFGKCGGYCGKCLPHMTTGLPIQVI
NT seq 5733 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtggccaagtggctgactgggctgctctaccatctctcgctcttcatcaccagg
tcttgggaagttgacttccaccccaggcaagaagccctggtgaggacactgacctcctac
gaagtagtgatccccgagcgggtcaatgagtttggagaagtgttccctcagagccaccac
ttcagccggcagaaacgcagctccgaggcgctggaacccatgccgttccgaacccactat
cgcttcactgcctacgggcagctcttccagctgaacctgaccgccgatgcatcctttctg
gccgccggctacaccgaggtgcacttgggaaccccggagcgcggggcctgggagagcgac
gcagggccctcggacctgcgccactgcttctaccgcggccaggtcaactcacaggaggat
tacaaggccgtcgtcagcttatgcggaggcctgacgggaacatttaaaggacagaacggt
gaatatttcttagaacctataatgaaggcagatgggaatgaatatgaagatggtcacaac
aagccacatcttatatacagacaagacttaaataactcttttctgcagactctgaagtat
tgcagtgtgtcagaaagtcaaataaaggaaaccagtttaccctttcatacctacagcaac
atgaatgaagatcttaatgtaatgaaagaaagagttttaggacacacatcaaaaaatgta
ccattgaaagatgaaagaagacattccaggaaaaaacgtcttatatcatatccaagatac
attgaaattatggttacagctgatgctaaagtggtttctgctcatggatcgaatttgcaa
aactatatactgactctaatgtcaattgttgcaacaatctacaaagatccaagtattgga
aatttgatacacatagtagtggtaaaattagttatgattcaccgtgaggaggaaggacca
gtcattaattttgatggtgctaccacattaaagaacttttgttcatggcaacaaactcag
aatgaccttgatgatgttcacccttcccaccatgacactgctgttcttatcactagggaa
gacatttgttcatctaaagagaaatgtaacatgttaggtttatcatatttaggtaccata
tgtgatcctttacaaagctgctttattaatgaagaaaaaggactcatttctgcttttact
atagcccatgagcttgggcacacacttggtgttcaacatgatgataatcctagatgtaaa
gaaatgaaagttacaaagtatcatgtaatggcccctgctttaagttttcacatgagtcct
tggagctggtcaaactgtagtcggaaatatgttactgaattcctagatactggttacggg
gaatgtcttcttgacaaaccagatgaagaaatatataatctgccttcagaacttcctgga
tcacgatatgatggaaacaagcagtgtgagcttgcgtttggtcctgggtcacaaatgtgt
ccccatataaatatatgcatgcatctgtggtgcacaagcacagaaaagcttcacaaaggc
tgtttcactcaacacgtgccaccagcagatggaacagactgcggtcctggaatgcattgc
cgtcatgggctatgtgtaaacaaagaaacggaaacacgtcctgtaaatggtgaatgggga
ccatgggaaccttacagttcttgttcaagaacatgtggaggcggaatcgaaagtgcaacc
aggcgctgtaatcgtcctgagccaagaaacggaggaaattactgtgtgggccgcaggatg
aaatttcgatcatgtaatactgattcatgtccaaaaggcacacaagactttcgagagaag
cagtgctctgattttaatggtaaacatttggacatcagtggcattccctctaatgtgagg
tggcttccaagatacagtggcattggcacaaaggatcgttgtaaactctattgtcaggtt
gctggaaccaattatttctacctattgaaggatatggttgaagatggtactccttgtgga
actgaaactcatgacatctgtgttcaaggccagtgtatggcagctggttgtgatcacgtg
ttaaactccagtgccaagatagacaaatgtggagtgtgtggtggggacaactcttcatgc
aagacaataacaggtgtcttcaacagttctcattatggttataatgttgttgtaaagatt
cccgcaggagcaacaaacgttgacattcgtcagtacagctattctggacaaccagatgac
agttaccttgcattatctgacgctgaagggaattttcttttcaatggaaattttcttcta
agtacgtcaaaaaaagaaatcaatgtgcaaggaacaagaactgttattgaatacagtgga
tcaaataacgcagttgaaagaattaatagtactaatcgacaagagaaagaacttattttg
caggtgttgtgtgtgggtaatttatacaaccctgatgtacattattccttcaatatccct
ttggaagagaggagtgacatgttcacatgggacccctatggaccatgggaaggctgtacc
aaaatgtgtcaaggtcttcagcgaagaaacataacttgcatacataagagtgatcatagt
gttgtgtctgataaagaatgtgaccacttgccacttccatcatttgttactcaaagttgc
aatacagactgtgaactaaggtggcatgttattggcaaaagtgaatgttcatcccaatgt
ggtcaaggatatagaaccttggacatccattgcatgaagtattccattcatgaaggacag
actgttcaagttgatgaccactactgtggtgaccagcttaaacctcctacccaagaacta
tgccatggtaactgtgtcttcacaagatggcattattcagaatggtctcagtgttccagg
agttgtggaggaggggaaaggtctcgagaatcttattgtatgaataactttggccatcgt
cttgctgacaatgaatgccaagaactgtcccgagtgacgagagagaattgcaatgaattt
tcctgtcccagttgggctgctagtgaatggagcgagtgccttgttacatgtggtaaagga
acaaagcagcggcaggtatggtgtcagctgaatgtagatcacttgagtgatggcttctgt
aattcaagtaccaaacctgaatctctgagtccatgtgaacttcatacatgtgcttcctgg
caagtaggaccatggggtccttgcacaaccacatgtggacatgggtatcagatgcgagat
gttaaatgtgtcaatgagctagctagtgcagtgttagaggacacagaatgccatgaagct
agtcgccccagtgacagacagagctgtgtacttacaccttgctcatttatttctaaactt
gagaccgctttattaccaactgttctcataaaaaagatggcacaatggcgacatggttct
tggaccccatgctccgtatcttgtggaagaggtactcaagcccgctatgtaagctgtcgt
gatgctcttgatagaatagcagatgaatcatattgtgcccacttaccccgacctgctgaa
atatgggactgttttaccccttgtggagagtggcaagcaggggattggtcaccctgttca
gcttcctgtggccatggaaaaacaactcgacaagttttatgcatgaactaccatcagcca
attgatgagaattactgtgatcctgaagttcgccctttgatggaacaggaatgtagcctg
gcagcctgccctcctgcacacagccactttcctagttcccctgtgcagccaagctattat
ctaagcacgaatttgccattaactcaaaaacttgaagataatgaaaatcaggtggtccat
ccatcagtcagaggaaaccagtggagaaccggaccatggggatcatgctccagcagttgt
tctggaggtcttcagcatagggctgtggtctgccaggatgaaaatggacaaagtgctagt
tactgcgatgcagcctccaagcctccagagttacagcaatgtggtccagggccttgtcca
cagtggaactacggaaattggggagaatgttcacaaacatgtggaggaggaataaaatca
agacttgtaatatgtcaatttcccaatggccaaatattagaagatcacaactgtgaaatt
gtaaacaagccacctagcgtaatacagtgtcatatgcatgcttgccctgctgatgtgtca
tggcatcaggaaccatggacatcgtgctcagcttcttgtggtaaaggtagaaagtaccgt
gaagtgttttgcattgaccaattccaaaggaaattagaagacacaaattgcagtcaagta
cagaaacctccaactcacaaagcctgtagatctgtcagatgcccttcatggaaagccaat
agctggaatgagtgctctgtgacctgtggctctggagttcagcagagggatgtatactgc
agactgaaaggtgttggtcaggtggttgaagaaatgtgtgatcagtccacccgaccttgt
tctcagaggcgatgttggagtcaggactgtgtgcagcacaaggggatggaaagagggagg
ctgaattgttcaacatcatgtgagagaaaagattcacatcaacgaatggagtgcacagat
aaccaaatcagacaagtgaatgaaatagtctataattcttcaaccatatctcttacatcc
aagaattgcaggaaccctccttgcaattacattgtggtaacagcagactcatcacagtgt
gcaaacaactgtggatttagttacagacaaaggattacatattgcaccgagatcccatct
actaagaaacataagctccatcgacttcggcctatagtttatcaagaatgccctgtggtg
ccttcctctcaggtttaccaatgcattaacagctgtttgcatttggccacttggaaagtt
ggaaaatggagcaagtgctcagtgacttgtggaattgggataatgaagagacaagtgaaa
tgcattaccaaacatggtttgtccagtgacttatgtttaaaccatttaaaaccaggtgct
caaaagaaatgttatgccaatgactgtaaatcatttaccacctgcaaagaaattcaagtg
aaaaaccacattagaaaggatggtgactattaccttaacattaagggaagaataataaag
atttattgtgcagacatgtacttggagaaccctaaggaatatttaacactggtccaaggt
gaagaaaacttttctgaagtgtatggctttagactaaaaaatccatatcaatgtcctttt
aatgggagtagaagggaagactgtgaatgtgacaatggacacttagctgctggatacact
gttttcagcaaaataagaattgatctcacttccatgcaaattaaaactacggaccttctt
ttttccaaaacaatatttggaaatgcagttccatttgccacagctggagattgctacagt
gctttcagatgcccacagggacagtttagcattaatttgtcaggaactgggatgaagata
tccagcacagcaaagtggctcactcaggggagttatacctctgtcagcatacgaagatca
gaggatggaactagatttttcggcaaatgtggagggtactgtggaaagtgtcttcctcac
atgactactggtctcccaattcaagtcatatga

DBGET integrated database retrieval system