KEGG   Homo sapiens (human): 80071
Entry
80071             CDS       T01001                                 

Gene name
CCDC15
Definition
(RefSeq) coiled-coil domain containing 15
  KO
K16752  coiled-coil domain-containing protein 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80071 (CCDC15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    80071 (CCDC15)
SSDB
Motif
Pfam: DUF1057
Other DBs
NCBI-GeneID: 80071
NCBI-ProteinID: NP_079280
HGNC: 25798
Ensembl: ENSG00000149548
Vega: OTTHUMG00000165940
Pharos: Q0P6D6(Tdark)
UniProt: Q0P6D6
Position
11q24.2
AA seq 951 aa
MLGSMARKKPRNTSRLPLALNPLKSKDVLAVLAERNEAIVPVGAWVEPASPGSSEIPAYT
SAYLIEEELKEQLRKKQEALKHFQKQVKYRVNQQIRLRKKQQLQKSYERAQKEGSIAMQS
SATHLTSKRTSVFPNNLNVAIGSSRLPPSLMPGDGIEDEENQNELFQQQAQALSETMKQA
RHRLASFKTVIKKKGSVFPDDGRKSFLTREEVLSRKPASTGINTGIRGELPIKVHQGLLA
AVPYQNYMENQELDYEEPDYEESSSLVTDEKGKEDLFGRGQQDQQAIHSEDKNKPFSRVQ
KVKFKNPLFVLMEEEEQKQLHFEGLQDILPEAQDYFLEAQGDLLETQGDLTGIQSVKPDT
QAVEMKVQVTEPEGQAIEPEGQPIKTETQGIMLKAQSIELEEGSIVLKTQDFLPTNQALL
TKNQDVLLKDHCVLPKDQSILLKYQDQDFLPRDQHVLHKDQDILPKYQDQNFLPKDQNFL
SRDQHVLPKDQDILPKYQDQNFLPKDQNFLSRDQHVLPKDQNILPKYQGQDFLPKDQDFL
SRDQHVLPKDWNILPKCQDQDFLPRDQGVLPKDQNILPICQDQDFLPRDQGYLPKDQNIL
PICQDRDFLPRDLHVLSNDQNILPKCQDQDFLPKYQKVHFKEPYSDMTDEKGREDFSLAD
YQCLPPKSQDQDDIKNQQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLP
SSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLRHRRL
FMDIEREQVKEQQRQKEQKKKIEKIKKKREQECYAAEQRILRMNFHEDPYSGEKLSEILA
QLQLQEIKGTREKQQREKEYLRYVEALRAQIQEKMQLYNITLPPLCCCGPDFWDAHPDTC
ANNCIFYKNHRAYTRALHSFINSCDVPGGNSTLRVAIHNFASAHRRTLKNL
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgctgggaagtatggcccgaaagaaacctcgaaatacctcaaggttgcccctggcttta
aaccccctgaagagcaaggacgtgttggcagtgctggctgagaggaacgaggctatagta
ccagttggggcatgggtggaacctgcctcaccaggtagttcggaaatcccagcatataca
tcagcatatttaattgaagaagaactaaaggaacagctaagaaaaaaacaagaagctttg
aaacattttcagaaacaagttaaataccgagtaaatcaacaaattaggttgagaaaaaag
caacagcttcagaagtcttatgaaagagcacaaaaagaaggctccatagccatgcagtct
tcagcaacacacttaacttccaaaaggacaagtgtttttccaaacaatttgaatgttgct
attggaagttctaggttacctccttccctgatgcctggggatggaatagaggatgaagag
aatcagaacgaattattccaacaacaagcccaggctcttagtgaaactatgaaacaggca
cgtcaccggctagcatcctttaaaaccgtgattaaaaaaaagggatcagtgtttccagat
gatggaaggaaaagctttcttaccagagaggaagtgctttccaggaaaccagcatccact
gggataaatacaggaataagaggagagttgcccattaaggtccatcaaggtcttttagct
gctgtaccttaccagaattatatggaaaatcaggaacttgactatgaggaacctgactat
gaggaatcttcatctcttgtaactgatgagaaagggaaagaagatttgtttgggagaggc
cagcaggaccagcaggctatccattctgaagataagaacaaacctttcagcagagttcag
aaagtaaaattcaaaaatccattatttgttctgatggaagaggaagaacaaaagcagtta
cattttgagggccttcaggatattctgccagaagcccaggattattttctagaagcccaa
ggtgatttgctggaaacccagggtgatttgacaggaatccagagtgttaagccagatacc
caggctgttgaaatgaaggttcaggttactgagccagaaggccaggccattgagccagaa
ggccagcctattaagacagaaactcagggtattatgctgaaagcccagagtattgagcta
gaagaagggagtattgtgttgaaaacccaggattttctacccacaaatcaggctcttcta
acgaaaaaccaggatgttttactcaaagaccactgtgttctccctaaagaccagagtatt
ctactcaaatatcaggaccaggacttcctacccagagaccagcatgttctccacaaagac
caagatattctgccaaaatatcaggaccagaattttctacctaaggaccagaatttttta
tctagagaccagcatgttctccccaaagaccaagatattctgccaaaatatcaggaccag
aattttctacctaaggaccagaattttttgtctagagaccagcatgttctccccaaagac
cagaatattctacctaaatatcaaggccaggattttctacctaaagaccaggacttttta
tctagagaccagcatgttctccccaaagactggaatattctacccaaatgtcaggaccag
gattttctacccagagaccaaggtgttcttcccaaagaccaaaatattctacccatatgt
caggaccaggattttctacccagagaccaaggttatcttcctaaagaccaaaatattcta
cccatatgtcaggaccgggattttctacccagagacctgcatgttctctccaacgaccag
aatattctacccaaatgtcaggaccaagattttctaccaaaatatcagaaagtacacttt
aaggagccatactctgatatgacagatgagaaagggagagaagacttttctctggcagac
tatcagtgtttgcctcccaaatcccaggaccaggatgacatcaaaaatcagcaacctgca
tcttttatgagagaagaaagagtgagagaagaattgcctctggactatcatcaatatgtt
gtacctaaaatccaggaccaagactcccctagagaacagaacaagcatatcaaactaccc
tcatcttttgagaaatgggagattgcaagaggaaatactcctggagtgcccttggcttat
gataggtatcaatcaggattgagcactgaattccaagctccactggcatttcagtctgac
gtggataaagaagaagataagaaagagcgtcaaaagcagtacctgagacatagacgactt
ttcatggatattgagagagaacaagttaaagaacaacaaaggcaaaaagaacaaaagaag
aaaattgaaaaaattaagaaaaagagagagcaagaatgttatgctgcagagcagaggatc
ctaagaatgaactttcatgaagatccatattcaggagagaagttgagtgagatattagcc
cagttacaacttcaagaaataaaaggaaccagagaaaaacaacagagagaaaaagaatac
ctgagatatgtagaagctttacgagcccaaatccaggagaaaatgcagctgtataatatt
actttacctccactatgctgttgtggtcctgatttttgggatgctcatcctgatacctgt
gccaacaactgtattttctataaaaaccacagagcatatactcgggcactacattcattc
atcaattcctgtgatgtccctgggggtaattcaactcttcgagtcgcaattcataatttt
gcttctgcacacaggcggactttgaaaaatctataa

DBGET integrated database retrieval system