KEGG   Homo sapiens (human): 8013Help
Entry
8013              CDS       T01001                                 

Gene name
NR4A3, CHN, CSMF, MINOR, NOR1, TEC
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 3
  KO
K08559  nuclear receptor subfamily 4 group A member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00138  EWSR1-NR4A3
Disease
H00053  Extraskeletal myxoid chondrosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8013 (NR4A3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8013 (NR4A3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    8013 (NR4A3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    8013 (NR4A3)
Nuclear receptors [BR:hsa03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   8013 (NR4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep SelP_N
Motif
Other DBs
NCBI-GeneID: 8013
NCBI-ProteinID: NP_008912
OMIM: 600542
HGNC: 7982
Ensembl: ENSG00000119508
Vega: OTTHUMG00000021030
Pharos: Q92570(Tbio)
UniProt: Q92570 A0A024R168
Position
9q31.1
AA seq 626 aa AA seqDB search
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAV
PTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALES
HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcgtccaagcccaatatagcccttcccctccaggttccagttatgcggcgcag
acatacagctcggaatacaccacggagatcatgaaccccgactacaccaagctgaccatg
gaccttggcagcactgagatcacggctacagccaccacgtccctgcccagcatcagtacc
ttcgtggagggctactcgagcaactacgaactcaagccttcctgcgtgtaccaaatgcag
cggcccttgatcaaagtggaggaggggcgggcgcccagctaccatcaccatcaccaccac
caccaccaccaccaccaccatcaccagcagcagcatcagcagccatccattcctccagcc
tccagcccggaggacgaggtgctgcccagcacctccatgtacttcaagcagtccccaccg
tccacccccaccacgccggccttccccccgcaggcgggggcgttatgggacgaggcactg
ccctcggcgcccggctgcatcgcacccggcccgctgctggacccgccgatgaaggcggtc
cccacggtggccggcgcgcgcttcccgctcttccacttcaagccctcgccgccgcatccc
cccgcgcccagcccggccggcggccaccacctcggctacgacccgacggccgctgccgcg
ctcagcctgccgctgggagccgcagccgccgcgggcagccaggccgccgcgcttgagagc
cacccgtacgggctgccgctggccaagagggcggccccgctggccttcccgcctctcggc
ctcacgccctcccctaccgcgtccagcctgctgggcgagagtcccagcctgccgtcgccg
cccagcaggagctcgtcgtctggcgagggcacgtgtgccgtgtgcggggacaacgccgcc
tgccagcactacggcgtgcgaacctgcgagggctgcaagggctttttcaagagaacagtg
cagaaaaatgcaaaatatgtttgcctggcaaataaaaactgcccagtagacaagagacgt
cgaaaccgatgtcagtactgtcgatttcagaagtgtctcagtgttggaatggtaaaagaa
gttgtccgtacagatagtctgaaagggaggagaggtcgtctgccttccaaaccaaagagc
ccattacaacaggaaccttctcagccctctccaccttctcctccaatctgcatgatgaat
gcccttgtccgagctttaacagactcaacacccagagatcttgattattccagatactgt
cccactgaccaggctgctgcaggcacagatgctgagcatgtgcaacaattctacaacctc
ctgacagcctccattgatgtatccagaagctgggcagaaaagattccgggatttactgat
ctccccaaagaagatcagacattacttattgaatcagcctttttggagctgtttgtcctc
agactttccatcaggtcaaacactgctgaagataagtttgtgttctgcaatggacttgtc
ctgcatcgacttcagtgccttcgtggatttggggagtggctcgactctattaaagacttt
tccttaaatttgcagagcctgaaccttgatatccaagccttagcctgcctgtcagcactg
agcatgatcacagaaagacatgggttaaaagaaccaaagagagtcgaagagctatgcaac
aagatcacaagcagtttaaaagaccaccagagtaagggacaggctctggagcccaccgag
tccaaggtcctgggtgccctggtagaactgaggaagatctgcaccctgggcctccagcgc
atcttctacctgaagctggaagacttggtgtctccaccttccatcattgacaagctcttc
ctggacaccctacctttctaa

DBGET integrated database retrieval system