KEGG   Homo sapiens (human): 80150Help
Entry
80150             CDS       T01001                                 

Gene name
ASRGL1, ALP, ALP1, CRASH
Definition
(RefSeq) asparaginase like 1
  KO
K13051  beta-aspartyl-peptidase (threonine type) [EC:3.4.19.5]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    80150 (ASRGL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     80150 (ASRGL1)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T2
   80150 (ASRGL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase_2
Motif
Other DBs
NCBI-GeneID: 80150
NCBI-ProteinID: NP_001077395
OMIM: 609212
HGNC: 16448
Ensembl: ENSG00000162174
Vega: OTTHUMG00000167513
Pharos: Q7L266(Tbio)
UniProt: Q7L266 A0A024R573
Structure
PDB: 

Position
11q12.3
AA seq 308 aa AA seqDB search
MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPE
FNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQ
GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNV
AYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQ
GKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPD
DTTITDLP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccatcgtagtggtccacggcggcggagccggtcccatctccaaggatcggaag
gagcgagtgcaccagggcatggtcagagccgccaccgtgggctacggcatcctccgggag
ggcgggagcgccgtggatgccgtagagggagctgtcgtcgccctggaagacgatcccgag
ttcaacgcaggttgtgggtctgtcttgaacacaaatggtgaggttgaaatggatgctagt
atcatggatggaaaagacctgtctgcaggagcagtgtccgcagtccagtgtatagcaaat
cccattaaacttgctcggcttgtcatggaaaagacacctcattgctttctgactgaccaa
ggcgcagcgcagtttgcagcagctatgggggttccagagattcctggagaaaaactggtg
acagagagaaacaaaaagcgcctggaaaaagagaagcatgaaaaaggtgctcagaaaaca
gattgtcaaaaaaacttgggaaccgtgggtgctgttgccttggactgcaaagggaatgta
gcctacgcaacctccacaggcggtatcgttaataaaatggtcggccgcgttggggactca
ccgtgtctaggagctggaggttatgccgacaatgacatcggagccgtctcaaccacaggg
catggggaaagcatcctgaaggtgaacctggctagactcaccctgttccacatagaacaa
ggaaagacggtagaagaggctgcggacctatcgttgggttatatgaagtcaagggttaaa
ggtttaggtggcctcatcgtggttagcaaaacaggagactgggtggcaaagtggacctcc
acctccatgccctgggcagccgccaaggacggcaagctgcacttcggaattgatcctgac
gatactactatcaccgaccttccctaa

DBGET integrated database retrieval system