KEGG   Homo sapiens (human): 80150
Entry
80150             CDS       T01001                                 

Gene name
ASRGL1, ALP, ALP1, CRASH
Definition
(RefSeq) asparaginase and isoaspartyl peptidase 1
  KO
K13051  L-asparaginase / beta-aspartyl-peptidase [EC:3.5.1.1 3.4.19.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    80150 (ASRGL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    80150 (ASRGL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     80150 (ASRGL1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     80150 (ASRGL1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T2
   80150 (ASRGL1)
SSDB
Motif
Pfam: Asparaginase_2
Other DBs
NCBI-GeneID: 80150
NCBI-ProteinID: NP_001077395
OMIM: 609212
HGNC: 16448
Ensembl: ENSG00000162174
Vega: OTTHUMG00000167513
Pharos: Q7L266(Tbio)
UniProt: Q7L266 A0A024R573
Structure
PDB: 

Position
11q12.3
AA seq 308 aa
MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPE
FNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQ
GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNV
AYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQ
GKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPD
DTTITDLP
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaatcccatcgtagtggtccacggcggcggagccggtcccatctccaaggatcggaag
gagcgagtgcaccagggcatggtcagagccgccaccgtgggctacggcatcctccgggag
ggcgggagcgccgtggatgccgtagagggagctgtcgtcgccctggaagacgatcccgag
ttcaacgcaggttgtgggtctgtcttgaacacaaatggtgaggttgaaatggatgctagt
atcatggatggaaaagacctgtctgcaggagcagtgtccgcagtccagtgtatagcaaat
cccattaaacttgctcggcttgtcatggaaaagacacctcattgctttctgactgaccaa
ggcgcagcgcagtttgcagcagctatgggggttccagagattcctggagaaaaactggtg
acagagagaaacaaaaagcgcctggaaaaagagaagcatgaaaaaggtgctcagaaaaca
gattgtcaaaaaaacttgggaaccgtgggtgctgttgccttggactgcaaagggaatgta
gcctacgcaacctccacaggcggtatcgttaataaaatggtcggccgcgttggggactca
ccgtgtctaggagctggaggttatgccgacaatgacatcggagccgtctcaaccacaggg
catggggaaagcatcctgaaggtgaacctggctagactcaccctgttccacatagaacaa
ggaaagacggtagaagaggctgcggacctatcgttgggttatatgaagtcaagggttaaa
ggtttaggtggcctcatcgtggttagcaaaacaggagactgggtggcaaagtggacctcc
acctccatgccctgggcagccgccaaggacggcaagctgcacttcggaattgatcctgac
gatactactatcaccgaccttccctaa

DBGET integrated database retrieval system