KEGG   Homo sapiens (human): 80152
Entry
80152             CDS       T01001                                 
Symbol
CENPT, C16orf56, CENP-T, SSMGA
Name
(RefSeq) centromere protein T
  KO
K11512  centromere protein T
Organism
hsa  Homo sapiens (human)
Disease
H02481  Syndromic disorder with short stature
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80152 (CENPT)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     80152 (CENPT)
SSDB
Motif
Pfam: CENP-T_N CENP-T_C CENP-S CBFD_NFYB_HMF Histone Bromo_TP TFIID-18kDa
Other DBs
NCBI-GeneID: 80152
NCBI-ProteinID: NP_079358
OMIM: 611510
HGNC: 25787
Ensembl: ENSG00000102901
Pharos: Q96BT3(Tbio)
UniProt: Q96BT3 B3KPB2
Position
16:complement(67828157..67847693)
AA seq 561 aa
MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRKLSGQTRTIAR
GRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQP
SRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGVDQGLSLSQEPQGNA
DASSLTRSLNLTFATPLQPQSVQRPGLARRPPARRAVDVGAFLRDLRDTSLAPPNIVLED
TQPFSQPMVGSPNVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQKNSPGKPAQFLAGEA
EEVNAFALGFLSTSSGVSGEDEVEPLHDGVEEAEKKMEEEGVSVSEMEATGAQGPSRVEE
AEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEPA
PAPGAAVLSSEPAEPLLVRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKAL
EMVEKCLDKYFQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLP
LEYRQLLIPCAYSGNSVFPAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggctgaccacaaccctgacagcgactccacgccgcgcacgctgctgcgacgcgtgctg
gatacagcggacccgcgcaccccgcggcgaccccggagtgctcgggctggagcccggaga
gccctgcttgaaacggcttcccccaggaagttgagtggccaaacaaggacgatagccaga
gggcgttcccatggagccaggtctgttggcagatcggcccatattcaggccagtgggcac
ttggaggaacagacacctcggacgctgctgaagaacatcctactaactgccccagaatct
tccatcctgatgcctgagtcggtagtgaagccagtgccagcaccgcaggcggtccaaccc
tccagacaagagagcagttgcggcagcctggagctgcaacttcctgagctcgagcccccc
acaaccctggctccaggtctgctggcccctggcaggaggaaacagaggctgagactgtca
gtgtttcagcagggagtggaccaggggctgtctctctcccaagagcctcaagggaatgct
gatgcctcttccctcaccagatccctcaacctgacctttgccacacctcttcagccacag
tcagtgcagaggcctggcttggcccgcagacctccagcccgccgagctgtagacgtgggt
gcctttttgcgggatctgcgagatacttccctggctcctccaaacattgtgttggaggac
acccagccgttctctcagcccatggttggctcccccaacgtgtatcactccctgccctgc
acgcctcacactggggctgaagacgctgagcaggctgccggtcgcaagacacagagcagt
gggcctgggctgcagaagaatagccctgggaaaccagcccagtttctggcaggagaggca
gaggaggtcaatgcctttgctctgggcttcctgagcaccagcagtggtgtctctggagaa
gatgaagtagagcccttacacgatggagttgaagaggcagagaaaaagatggaagaagaa
ggtgtgagtgtgagtgaaatggaggcaacaggagcacaaggacccagcagggtagaagag
gctgagggacacacagaggtgacagaagcagagggatcccaggggactgctgaggctgac
gggccaggagcatcttcaggggatgaggatgcctctggcagggcagcaagtccagagtcg
gcctccagcacccctgagtctctccaggccaggcgacatcatcagtttcttgagccagcc
ccagcgcctggtgctgcagtcttatcttcagagcctgcagagcctctgttggtcaggcat
ccccctaggccccggaccaccggccccaggccccggcaagatccccacaaggctggactg
agccactatgtgaaactctttagcttctatgccaagatgcccatggagaggaaggctctt
gagatggtggagaagtgcctagataaatatttccagcatctttgtgatgatctggaggta
tttgctgctcatgctggccgcaagactgtgaagccagaggacctggagctgctgatgcgg
cggcagggcctggtcactgaccaagtctcactgcacgtgctagtggagcggcacctgccc
ctggagtaccggcagctgctcatcccctgtgcatacagtggcaactctgtcttccctgcc
cagtag

DBGET integrated database retrieval system