KEGG   Homo sapiens (human): 80155
Entry
80155             CDS       T01001                                 
Symbol
NAA15, Ga19, MRD50, NARG1, NAT1P, NATH, TBDN, TBDN100
Name
(RefSeq) N-alpha-acetyltransferase 15, NatA auxiliary subunit
  KO
K20792  N-alpha-acetyltransferase 15/16, NatA auxiliary subunit
Organism
hsa  Homo sapiens (human)
Disease
H00773  Autosomal dominant intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80155 (NAA15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    80155 (NAA15)
SSDB
Motif
Pfam: NatA_aux_su TPR_2 TPR_14 TPR_19 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_1 TPR_15 Peptidase_S30
Other DBs
NCBI-GeneID: 80155
NCBI-ProteinID: NP_476516
OMIM: 608000
HGNC: 30782
Ensembl: ENSG00000164134
UniProt: Q9BXJ9 B2RBE5
Structure
Position
4:139301505..139391384
AA seq 866 aa
MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDL
SLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQT
SPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL
EDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNF
LSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFN
PNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKH
AGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLN
EMQCMWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVD
LLKLEDVLRQHPFYFKAARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQR
RAQKKAQIEEEKKNAEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKF
LTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAV
CESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQ
KRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMP
PGYEEDMKITVNGDSSAEAEELANEI
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgccggccgtgagcctcccgcccaaggagaatgcgctcttcaagcggatcttgaggtgt
tatgaacataaacagtatagaaatggattgaaattctgtaaacaaatactttctaatccc
aaatttgcagagcatggagaaaccttggctatgaaaggattaacattgaactgtttgggg
aaaaaggaagaagcttatgaattggttcgtagaggtttgagaaatgacttgaagagtcat
gtgtgttggcacgtttatggccttcttcagaggtcagacaagaagtatgatgaagccatt
aagtgttacagaaatgcactaaaatgggataaagacaatcttcaaatcttaagggacctt
tccttactacagattcaaatgcgagatcttgagggttacagggaaacgaggtatcagtta
cttcagcttcgacctgcgcagagagcatcatggattggttatgctattgcttaccattta
ttagaagattatgaaatggcagcaaagattttagaagaatttaggaaaacacaacagaca
tcccctgacaaggtggattatgaatatagtgaactactcttatatcagaatcaagttctt
cgggaagcaggtctctatagagaagctttggaacatctttgtacctatgaaaagcagatt
tgtgataaacttgctgtagaagaaaccaaaggggaacttctgttgcaactatgtcgtttg
gaagatgctgcagatgtttatagaggattgcaagagagaaatcctgaaaactgggcctat
tacaaaggcttggaaaaagcactcaagccagctaatatgttagaacggctaaaaatttat
gaggaagcctggactaaatatcccaggggactggtgccaagaaggctgccgttaaacttt
ttatctggtgagaagtttaaagaatgtttggataagttcctaaggatgaatttcagcaag
ggttgcccaccagtcttcaatactttaagatcattatacaaagacaaagaaaaggtggca
atcatagaagagttagtagtaggttatgaaacctctctaaaaagctgccggttatttaac
cccaatgatgatggaaaggaggaaccaccaaccacattactttgggtccagtactacttg
gcacaacattatgacaaaattggtcagccatctattgctttggagtacataaatactgct
attgaaagtacacctacattaatagaactctttctcgtgaaagctaaaatctataagcat
gctggaaatattaaagaagctgcaaggtggatggatgaggcccaggccttggacacagca
gacagatttatcaactccaaatgtgcaaaatacatgctaaaagccaacctgattaaagaa
gctgaagaaatgtgctcaaagtttacaagggaaggaacatcagcggtagagaatttgaat
gaaatgcagtgcatgtggttccaaacagaatgtgcccaggcttataaagcaatgaataaa
tttggtgaagcacttaagaaatgtcatgagattgagagacattttatagaaatcactgat
gaccagtttgactttcatacatactgtatgaggaagattacccttagatcatatgtggac
ttattaaaactagaagatgtacttcgacagcatccattttacttcaaggcagcaagaatt
gctatagagatctatttgaagcttcatgacaacccccttacagatgagaataaagaacac
gaagctgatacagcaaacatgtctgacaaagagctaaagaagctacgtaataaacaaaga
agagctcaaaagaaagcccagatagaagaagagaaaaaaaatgcagaaaaagaaaagcag
cagagaaatcagaaaaagaagaaggatgatgatgatgaggagataggaggtccaaaagaa
gaacttattccagagaaactggccaaggttgaaactccattggaagaagctattaaattt
ttaacaccgttgaagaacttggtgaagaacaagatagagactcatctttttgcctttgag
atttactttaggaaagaaaagtttcttttgatgctacaatcagtaaagagggcatttgct
attgattctagtcatccctggcttcatgagtgtatgattcgtctctttaatactgcagtg
tgtgaaagtaaagatttatctgatacagttagaacagtattaaaacaagaaatgaatcgt
ctttttggagcaacgaatccaaagaattttaatgaaacttttctgaaaaggaattctgat
tcattgccacacagattatcagctgccaaaatggtatattacttagatccttctagtcag
aagcgagctatagagttggcaacaacacttgatgaatctctcactaacagaaacctccag
acatgtatggaggtattggaagccttgtatgatggtagcctaggagactgtaaagaagct
gctgaaatttatagagcaaattgtcataagcttttcccttatgctttggctttcatgcct
cctggatatgaagaggatatgaagatcacagttaatggagatagttctgcagaagctgaa
gaactggccaatgaaatttga

DBGET integrated database retrieval system