KEGG   Homo sapiens (human): 80162Help
Entry
80162             CDS       T01001                                 

Gene name
PGGHG, ATHL1
Definition
(RefSeq) protein-glucosylgalactosylhydroxylysine glucosidase
  KO
K22078  protein-glucosylgalactosylhydroxylysine glucosidase [EC:3.2.1.107]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    80162 (PGGHG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.107  protein-glucosylgalactosylhydroxylysine glucosidase
     80162 (PGGHG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_65m
Motif
Other DBs
NCBI-GeneID: 80162
NCBI-ProteinID: NP_079368
OMIM: 617032
HGNC: 26210
Ensembl: ENSG00000142102
Vega: OTTHUMG00000153218
Pharos: Q32M88(Tdark)
UniProt: Q32M88 A0A024R1Z9
Position
11p15.5
AA seq 737 aa AA seqDB search
MEDAGEDPTTFAAHSLPSDPRLLATVTNAYLGTRVFHDTLHVSGVYNGAGGDTHRAMLPS
PLNVRLEAPAGMGEQLTETFALDTNTGSFLHTLEGPRFRASQCIYAHRTLPHVLAFRVSI
ARLAPGSGPITLLLRSAFSPESPDLDLHQGPDFQGARYLYGHTLTPEQPGGPQQEVHMLW
TPAPPDLTLGEGEEARTWDFLTAVGGSQAEAQACLTEALQLQARGALYTAHAQAWAQLWV
ECGLDVVGPLQLRQALRGSLYYLLSALPQPKAPGYICHGLSPGGLSNGSREECYWGHVFW
DQDLWMFPSILMFHPEAARAILEYRIRTLDGALENAQNLGYQGAKFAWESADSGLEVCPE
DIYGVQEVHVNGAVVLAFELYYHTTQDLQLFREAGGWDVVRAVAEFWCSRVEWSPREEKY
HLRGVMSPDEYHSGVNNSVYTNVLVQNSLRFAAALAQDLGLPIPSQWLAVADKIKVPFDV
EQNFHPEFDGYEPGEVVKQADVVLLGYPVPFSLSPDVRRKNLEIYEAVTSPQGPAMTWSM
FAVGWMELKDAVRARGLLDRSFANMAEPFKVWTENADGSGAVNFLTGMGGFLQAVVFGCT
GFRVTRAGVTFDPVCLSGISRVSVSGIFYQGNKLNFSFSEDSVTVEVTARAGPWAPHLEA
ELWPSQSRLSLLPGHKVSFPRSAGRIQMSPPKLPGSSSSEFPGRTFSDVRDPLQSPLWVT
LGSSSPTESLTVDPASE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgccggcgaggaccccaccacgtttgctgcccactctctgcccagtgacccc
cgtctcttggccactgtgaccaacgcatacctgggcacacgagtgtttcacgacacgctg
cacgtgagcggcgtgtacaatggggctggcggggacacgcaccgggccatgctgcccagc
cccctcaacgtccggctggaggcccctgcagggatgggggagcagctgaccgagaccttc
gccctggacaccaacacaggctcctttcttcacaccctggagggcccccgcttccgggcc
tcccagtgcatctatgcgcatcgcacgctgccccacgtgctggctttccgagtgtccatc
gcccgcctggccccggggagcgggcccatcacgctgctcctgcggtcagccttctcccca
gaaagcccagacctggacctgcatcagggtcctgacttccagggagcccggtacctgtat
ggccacaccctcacccctgagcagcccggggggccacagcaagaggtacacatgctgtgg
acaccagcacccccagacctgacccttggggaaggtgaggaggctaggacgtgggacttc
ctgacagcagtgggcggcagccaggctgaggctcaggcctgcctcactgaggccctgcag
ctgcaggccaggggagctctgtatacggctcacgcacaggcctgggcccagctctgggta
gaatgtggcttggacgtggtggggcccctgcagctgcgccaggccctgcgtggctccctc
tactacctgctcagtgccctgccccagcccaaggccccaggatacatctgccatggcctc
agtcctgggggcctctccaatgggagccgtgaggaatgctactggggccacgtcttctgg
gaccaggacctctggatgttcccgagtatcctgatgttccacccagaagccgccagggcc
atcctggagtaccgcatccgcacgctggacggggccctggagaacgcccagaacctgggc
taccagggagccaagtttgcctgggagagtgcagactccggcctagaggtttgccctgag
gacatttacggagtccaggaggtccacgtcaacggggccgtggtgttggccttcgagctg
tactaccataccacccaggacctgcagctatttcgagaggctggtggctgggacgtggtc
agggctgtggccgagttttggtgcagtcgtgttgagtggagccccagggaggaaaagtac
cacctgaggggagtcatgtcccccgacgagtaccattcaggggtcaacaactctgtgtac
accaacgtcctggtccagaacagcctgcgctttgctgctgccctggcccaggacctgggt
cttcccatccccagccagtggctggcggtggctgacaagatcaaggtaccctttgacgtg
gagcagaacttccacccggagttcgatgggtatgagcctggagaggtggtgaagcaggca
gacgtcgtgctcctgggatacccagtccccttctccctgagtcctgatgttcgcaggaaa
aatctggagatttacgaggctgtgacgtccccccagggccccgccatgacctggagcatg
tttgctgtgggctggatggagctgaaggacgcagtgcgggcccggggcctcctggacagg
agctttgccaacatggctgaacccttcaaggtgtggacggagaatgcagacgggtcaggc
gctgtgaacttcctgacaggcatggggggcttcctgcaggcggtggtcttcgggtgcacg
gggttcagggtcacccgagcgggtgtgacctttgaccctgtgtgtctgtcggggatctcc
agagtgagcgtctccggcatcttctaccaggggaacaagctcaacttctctttttccgag
gactccgtgaccgtggaggtcacagctcgagcagggccctgggctcctcacctggaggct
gagctgtggccatcccagtcccggctctccctgttgccaggacacaaggtctcctttccc
cgctcggctggccggatacaaatgtcacccccgaagctgcctggaagttccagctccgag
ttccctgggaggactttttcagatgttagggacccgctccagagccccctctgggtcacc
ctgggttcctccagccccaccgagtcactcactgtggaccctgcctctgaataa

DBGET integrated database retrieval system