KEGG   Homo sapiens (human): 80176Help
Entry
80176             CDS       T01001                                 

Gene name
SPSB1, SSB-1, SSB1
Definition
(RefSeq) splA/ryanodine receptor domain and SOCS box containing 1
  KO
K10343  SPRY domain-containing SOCS box protein 1/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80176 (SPSB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     80176 (SPSB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY SOCS_box
Motif
Other DBs
NCBI-GeneID: 80176
NCBI-ProteinID: NP_079382
OMIM: 611657
HGNC: 30628
Ensembl: ENSG00000171621
Vega: OTTHUMG00000001279
Pharos: Q96BD6(Tdark)
UniProt: Q96BD6 A0A024R4G8
Structure
PDB: 

Position
1p36.22
AA seq 273 aa AA seqDB search
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaggtcactggagggatcaagactgtggacatgagggaccccacgtacagg
cccctgaagcaggagctccagggtctggattactgcaagcccacccggctggatctgcta
ctggacatgccccctgtgtcctatgatgtccagctgctgcattcatggaacaacaacgac
cgatcgctcaatgtctttgtgaaggaggacgacaagctcatctttcaccggcatccggtg
gcccagagcacggacgctatcaggggcaaagtcgggtatacccgtgggctgcacgtgtgg
cagatcacgtgggccatgagacagcggggcacacacgccgtggtgggggtggcgacggca
gacgcccccctgcactctgtcgggtacacaaccctcgtggggaataaccacgagtcctgg
ggctgggacttggggcgcaaccggctctaccacgatggcaagaaccagccaagcaaaaca
tacccagcctttctggaaccagatgagacattcattgtccctgactccttcctggtagcc
ctggacatggacgacgggactctgagcttcattgtggatggacagtacatgggagtggct
tttcggggactcaagggcaaaaaactgtatcctgtagtgagtgccgtctggggccactgt
gagatccgaatgcgctacttgaacggactcgatcccgagccgctgccgctcatggatttg
tgccgtcgctcggtgcgcctggccctggggagggagcgcctgggggagatccacacgctg
ccgctgccggcttccctcaaggcctacctcctctaccagtga

DBGET integrated database retrieval system