KEGG   Homo sapiens (human): 80177Help
Entry
80177             CDS       T01001                                 

Gene name
MYCT1, MTLC
Definition
(RefSeq) MYC target 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_target_1 HemY_N
Motif
Other DBs
NCBI-GeneID: 80177
NCBI-ProteinID: NP_079383
OMIM: 616805
HGNC: 23172
Ensembl: ENSG00000120279
Vega: OTTHUMG00000015850
Pharos: Q8N699(Tbio)
UniProt: Q8N699
Position
6q25.2
AA seq 235 aa AA seqDB search
MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPW
PENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGL
NRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVET
ESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacacaagtatatgaggggttgtgtaaaaattatttttctcttgctgtactacaa
agagatagaatcaaactgctttttttcgacatactggtttttctttctgtttttcttctc
tttcttctatttcttgtggatattatggctaataacacaacaagtttagggagtccatgg
ccagaaaacttttgggaggaccttatcatgtccttcactgtatccatggcaatcgggctg
gtacttggaggatttatttgggctgtgttcatttgtctgtctcgaagaagaagagccagt
gctcccatctcacagtggagttcaagcaggagatctaggtcttcttacacccacggcctc
aacagaactggattttaccgccacagtggctgtgaacgtcgaagcaacctcagcctggcc
agtctcaccttccagcgacaagcttccctggaacaagcaaattcctttccaagaaaatca
agtttcagagcttctactttccatccctttctgcaatgtccaccacttcctgtggaaact
gagagtcagctggtgactctcccttcttccaatatctctcccaccatcagcacttcccac
agtctgagccgtcctgactactggtccagtaacagtcttcgagtgggcctttcaacaccg
cccccacctgcctatgagtccatcatcaaggcattcccagattcctga

DBGET integrated database retrieval system