KEGG   Homo sapiens (human): 80183Help
Entry
80183             CDS       T01001                                 

Gene name
RUBCNL, C13orf18, KIAA0226L, PACER
Definition
(RefSeq) rubicon like autophagy enhancer
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_9
Motif
Other DBs
NCBI-GeneID: 80183
NCBI-ProteinID: NP_001273690
HGNC: 20420
Ensembl: ENSG00000102445
Vega: OTTHUMG00000016868
Pharos: Q9H714(Tbio)
UniProt: Q9H714
Position
13q14.13
AA seq 662 aa AA seqDB search
MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQ
QQPQDLQSQVPAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGS
SEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGA
VQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKE
VSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKC
DVDEFVILELGDFNDITETCSCSCSSSKSVTYEPDFNSAELLAKELYRVFQKCWILSVVN
SQLAGSLSAAGSIVVNEECVRKDFESSMNVVQEIKFKSRIRGTEDWAPPRFQIIFNIHPP
LKRDLVVAAQNFFCAGCGTPVEPKFVKRLRYCEYLGKYFCDCCHSYAESCIPARILMMWD
FKKYYVSNFSKQLLDSIWHQPIFNLLSIGQSLYAKAKELDRVKEIQEQLFHIKKLLKTCR
FANSALKEFEQVPGHLTDELHLFSLEDLVRIKKGLLAPLLKDILKASLAHVAGCELCQGK
GFICEFCQNTTVIFPFQTATCRRCSACRACFHKQCFQSSECPRCARITARRKLLESVASA
AT
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcacaatctacagtcaggcaggattctcctgtggagccctgggaagggatcagc
gatcactctggcattattgatggttcgcccagactcctgaacactgaccatcctccttgc
caattagacatcaggctcatgaggcacaaagctgtctggattaacccccaggatgtgcag
caacagccgcaggacttgcaatctcaggtgccagcagcagggaacagtgggacccatttt
gtgacagatgctgcctctccctcaggcccttcaccttcgtgcctcggggactccctggca
gagacaacgttgtctgaggataccacagactccgttggcagcgcttctccccatggctcg
agtgaaaagagtagcagcttctctctgtcctcaacagaggtacacatggtccgcccagga
tactctcatcgggtgtctctgcccacaagccctgggattttggccacctccccatatcct
gagactgacagtgctttttttgagccttcccatctgacatctgctgctgatgaaggtgct
gttcaagtcagtagaagaaccatttcttcgaattccttctcaccagaggtatttgtgctg
cctgttgatgtagaaaaggaaaatgcccacttttatgttgcagatatgattatatcagca
atggagaaaatgaagtgtaacattctgagtcaacagcagacagagagctggagtaaagaa
gtcagtgggttacttgggagtgatcagcctgactctgaaatgacttttgataccaacata
aagcaagagtctgggtcttctacttcttcatacagtggctatgaaggttgtgctgtgtta
caggtcagcccagtgactgaaacacgtacttaccatgatgtgaaagagatttgcaaatgc
gatgttgatgaatttgttattttagagcttggagattttaatgatatcacagaaacctgt
agctgttcctgcagctcctctaagagtgtcacttatgagccagacttcaattctgcagaa
ctattagccaaagagctgtaccgcgtgttccagaagtgctggatactgtcagtagttaat
tctcagctggcaggttccctgagtgcagctggctcgatagtcgtaaatgaagagtgtgtc
cgaaaagactttgaatccagtatgaatgtagtacaggaaattaaatttaagtctaggatc
agagggactgaagactgggctcctcctagatttcaaatcatatttaatattcatccacca
ctcaagagggaccttgtggtggcagcccagaattttttctgtgccggctgtggaactcca
gtagagcctaagtttgtgaagcggctccggtactgcgaatacctagggaagtatttctgt
gactgctgccactcatatgcagagtcgtgcatccctgcccgaatcctgatgatgtgggac
ttcaagaagtactacgtcagcaatttctccaaacagctgctcgacagcatatggcaccag
cccattttcaatttgctgagcatcggccaaagcctgtatgcgaaagccaaggagctggac
agagtgaaggaaattcaggagcagctcttccatatcaagaagctgttgaagacctgtagg
tttgctaacagtgcattaaaggagttcgagcaggtgccgggacacttgactgatgagctc
cacctgttctcccttgaggacctggtcaggatcaagaaagggctgctggcacccttactc
aaggacattctgaaagcttcccttgcacatgtggctggctgtgagctgtgtcaaggaaag
ggctttatttgtgaattttgccagaatacgactgtcatcttcccatttcagacagcaaca
tgtagaagatgttcagcgtgcagggcttgctttcacaaacagtgcttccagtcctccgag
tgcccccggtgtgcgaggatcacagcgaggagaaaacttctggaaagtgtggcctctgca
gcaacatga

DBGET integrated database retrieval system