KEGG   Homo sapiens (human): 8019Help
Entry
8019              CDS       T01001                                 

Gene name
BRD3, ORFX, RING3L
Definition
(RefSeq) bromodomain containing 3
  KO
K11721  bromodomain-containing protein 3
Organism
hsa  Homo sapiens (human)
Drug target
Apabetalone: D11131
Birabresib: D10911
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8019 (BRD3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8019 (BRD3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   8019 (BRD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    8019 (BRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET IMUP
Motif
Other DBs
NCBI-GeneID: 8019
NCBI-ProteinID: NP_031397
OMIM: 601541
HGNC: 1104
Ensembl: ENSG00000169925
Vega: OTTHUMG00000021004
Pharos: Q15059(Tchem)
UniProt: Q15059 A0A024R8H6
Structure
PDB: 

Position
9q34.2
AA seq 726 aa AA seqDB search
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgccacgacagtcgcccccgcggggatcccggcgaccccgggccctgtgaac
ccaccccccccggaggtctccaaccccagcaagcccggccgcaagaccaaccagctgcag
tacatgcagaatgtggtggtgaagacgctctggaaacaccagttcgcctggcccttctac
cagcccgtggacgcaatcaaattgaacctgccggattatcataaaataattaaaaaccca
atggatatggggactattaagaagagactagaaaataattattattggagtgcaagcgaa
tgtatgcaggacttcaacaccatgtttacaaattgttacatttataacaagcccacagat
gacatagtgctaatggcccaagctttagagaaaatttttctacaaaaagtggcccagatg
ccccaagaggaagttgaattattaccccctgctccaaagggcaaaggtcggaagccggct
gcgggagcccagagcgcaggtacacagcaagtggcggccgtgtcctctgtctccccagcg
accccctttcagagcgtgccccccaccgtctcccagacgcccgtcatcgctgccacccct
gtaccaaccatcactgcaaacgtcacgtcggtcccagtccccccagctgccgccccacct
cctcctgccacacccatcgtccccgtggtccctcctacgccgcctgtcgtcaagaaaaag
ggcgtgaagcggaaagcagacacaaccactcccacgacgtcggccatcactgccagccgg
agtgagtcgcccccgccgttgtcagaccccaagcaggccaaagtggtggcccggcgggag
agtggtggccgccccatcaagcctcccaagaaggacctggaggacggcgaggtgccccag
cacgcaggcaagaagggcaagctgtcggagcacctacgctactgcgacagcatcctcagg
gagatgctatccaagaagcacgcggcctacgcctggcccttctacaagccagtggatgcc
gaggccctggagctgcacgactaccacgacatcatcaagcacccgatggacctcagcacc
gtgaaaaggaagatggatggccgagagtacccagacgcacagggctttgctgctgatgtc
cggctgatgttctcgaattgctacaaatacaatcccccagaccacgaggttgtggccatg
gcccggaagctccaggacgtgtttgagatgaggtttgccaagatgccagatgagcccgtg
gaggcaccggcgctgcctgcccccgcggcccccatggtgagcaagggcgctgagagcagc
cgtagcagtgaggagagctcttcggactcaggcagctcggactcggaggaggagcgggcc
accaggctggcggagctgcaggagcagctgaaggccgtgcacgagcagctggccgccctg
tctcaggccccagtaaacaaaccaaagaagaagaaggagaagaaggagaaggagaagaag
aagaaggacaaggagaaggagaaggagaagcacaaagtgaaggccgaggaagagaagaag
gccaaggtggctccgcctgccaagcaggctcagcagaagaaggctcctgccaagaaggcc
aacagcacgaccacggccggcagacagctgaagaaaggcggcaagcaggcatctgcctcc
tacgactcagaggaagaggaggagggcctgcccatgagctacgatgaaaagcgccagctt
agcctggacatcaaccggctgcccggggagaagctgggccgggtagtgcacatcatccaa
tctcgggagccctcgctcagggactccaaccccgacgagatagaaattgactttgagact
ctgaaacccaccactttgcgggaactggagagatatgtcaagtcttgtttacagaaaaag
caaaggaaaccgttctcagcaagcgggaagaaacaggcagccaagtcgaaagaggagcta
gctcaggaaaagaagaaggagctggaaaagcgtctgcaggatgtcagcgggcagctgagc
agcagcaagaagcccgcccggaaagagaagcccggctcagcaccctcagggggcccgtcc
aggctcagcagcagcagctcctccgagtctgggagcagcagctccagcgggtccagctct
gacagcagtgactcagaatga

DBGET integrated database retrieval system