KEGG   Homo sapiens (human): 80194
Entry
80194             CDS       T01001                                 

Gene name
TMEM134
Definition
(RefSeq) transmembrane protein 134
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF872 DUF2207 DUF308 DUF3040 Neurensin
Other DBs
NCBI-GeneID: 80194
NCBI-ProteinID: NP_079400
HGNC: 26142
Ensembl: ENSG00000172663
Vega: OTTHUMG00000168034
Pharos: Q9H6X4(Tdark)
UniProt: Q9H6X4
Position
11q13.2
AA seq 195 aa
MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNL
ENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKN
RRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVK
GHRGFQFFYLPYFEK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgagcgccgcccggccccagttcagcattgatgatgccttcgagctgtccctggaggac
gggggccctgggcccgagtccagcggggtcgcgcgctttgggccgctgcacttcgagcgt
cgggcccggttcgaggtggctgacgaggacaagcagtcccggctgcgctaccagaacctg
gagaacgatgaggatggagcccaggcctctccggagccggatgggggagtcggcaccagg
gattccagccgaacttccatccgcagctcccagtggtccttcagcaccatcagcagcagc
acccagcgctcctacaacacctgctgcagctggacccaacaccctttgatccagaagaac
cgccgagtggtgctggcctccttcctgctcctgctgctggggctggtgctgatcctggtc
ggcgtgggactggaggcgaccccctctccaggtgtctccagcgccatcttcttcgtgccg
ggcttcctgttgttggtgcctggagtctatcacgtgatcttcatctactgcgcggtcaag
ggccaccggggcttccagttcttctacctgccctacttcgagaagtga

DBGET integrated database retrieval system