KEGG   Homo sapiens (human): 80196Help
Entry
80196             CDS       T01001                                 

Gene name
RNF34, CARP-1, CARP1, RFI, RIF, RIFF, hRFI
Definition
(RefSeq) ring finger protein 34
  KO
K20804  E3 ubiquitin-protein ligase RNF34 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80196 (RNF34)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     80196 (RNF34)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    80196 (RNF34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 Armet SAP zf-C3HC4_2 Prok-RING_4 Utp14
Motif
Other DBs
NCBI-GeneID: 80196
NCBI-ProteinID: NP_079402
OMIM: 608299
HGNC: 17297
Ensembl: ENSG00000170633
Vega: OTTHUMG00000171524
Pharos: Q969K3(Tbio)
UniProt: Q969K3
Position
12q24.31
AA seq 372 aa AA seqDB search
MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFF
SNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAE
DRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLY
KENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICR
QYVVRAVHVFKS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgggtgccacgtctatgtgggcttcgtgctgtgggctgctgaatgaagtcatg
ggaactggagctgtcaggggccagcagtcagcatttgcaggagccaccggtccattcaga
tttacaccaaaccctgagttttccacctacccaccagcagctacggaagggcccaacata
gtttgtaaagcctgtgggctttcattttcagtctttagaaagaagcatgtttgctgtgac
tgcaagaaggatttttgctccgtttgttcagtcttacaagaaaatctccgtagatgttct
acttgtcacttattacaagagacagcatttcagcgccctcagttaatgcgactgaaggtg
aaggacctgcggcagtatctcattctgagaaatatacccatagatacttgtcgtgagaaa
gaagacttggtggatctagtactgtgccatcatggactaggctctgaggacgacatggac
acaagcagtctgaattcttcaaggtcccagacttctagcttttttacacgttcgtttttt
tcaaactatacagccccctctgctactatgtcttcgtttcagggagagcttatggatgga
gaccaaacatccagatctggagtgccggcacaggtacaaagtgaaatcacttcagcaaac
acagaagatgatgatgacgacgatgatgaggatgatgatgatgaagaagaaaacgcagag
gatcggaaccccgggctctccaaggagagagtgagagcttcactgtctgacttgtcaagc
cttgatgatgtggaaggaatgagcgtgcgccagctgaaggaaattctggctcggaatttt
gtcaactattctggctgttgtgaaaaatgggaactggtagagaaagtaaaccggttatac
aaagagaatgaagaaaaccaaaagtcctatggcgagcggctgcagctgcaggatgaggaa
gacgacagcctgtgtcgcatctgcatggatgccgtcatcgactgtgtcctactggagtgt
gggcacatggttacctgcaccaagtgcggcaagcgcatgagtgagtgtcccatctgccgg
cagtatgtggtgcgagccgtgcacgtgttcaagtcctga

DBGET integrated database retrieval system