KEGG   Homo sapiens (human): 80210Help
Entry
80210             CDS       T01001                                 

Gene name
ARMC9, ARM, JBTS30, KU-MEL-1, NS21
Definition
(RefSeq) armadillo repeat containing 9
  KO
K22864  LisH domain-containing protein ARMC9
Organism
hsa  Homo sapiens (human)
Disease
H00530  Joubert syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80210 (ARMC9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    80210 (ARMC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOP_dimer CENP-B_dimeris AP3D1
Motif
Other DBs
NCBI-GeneID: 80210
NCBI-ProteinID: NP_001278585
OMIM: 617612
HGNC: 20730
Ensembl: ENSG00000135931
Vega: OTTHUMG00000133229
Pharos: Q7Z3E5(Tbio)
UniProt: Q7Z3E5 A0A024R486
Position
2q37.1
AA seq 665 aa AA seqDB search
MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQK
DLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEE
LDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLE
KFLALISKASNTPKLLTIYKENGQSNKEILQQLHQQLVEAERRSVTYLKRYNKIQADYHN
LIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQSLAHSVDFTRPGTASTMLRA
SLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAY
ISNDLLDCYSHNQRSVLQLLHSTSDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLEG
RLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSV
ALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEAR
AMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEAD
LDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPGGHR
NGYPV
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgggggacattctggctcatgaatctgaattacttggactagtgaaagagtatttagat
tttgctgaatttgaagacaccttgaaaacattttcaaaagaatgcaaaataaaaggaaaa
ccattgtgtaaaacagtaggcggatctttcagagactccaaatcattgacaattcagaag
gatcttgtcgctgcatttgacaacggagaccagaaggtgttcttcgatctgtgggaggag
cacatttcaagttccatccgagatggggactcctttgcccagaagctggaattctatctc
cacatccattttgccatctatcttttgaagtactctgtggggagaccggacaaagaggag
ctggatgaaaagatttcctacttcaaaacctacctggagaccaaaggggcagccttgagc
cagaccacagagtttcttcctttctatgcccttccttttgttcccaaccctatggtgcac
ccctcatttaaagaactcttccaggattcctggactccagagttaaagttgaagttggaa
aagtttctagctttaatatctaaagccagcaacacgccaaagcttttaacaatatataag
gagaatggacaaagtaacaaagaaatcttgcagcagctccaccagcagctggttgaagct
gaacgtaggtcagtgacatacctcaaacggtacaataagatccaggccgactaccacaat
ctcattggagtcacagcagagctggtggattctctagaggccacagtcagcggcaagatg
atcacccctgagtacctccagagcgtctgtgtccgcctgttcagtaaccagatgcggcag
agcctggcgcatagtgtggacttcacgaggcctgggacggcatccaccatgttacgagcc
tccttggcacccgtgaaattgaaggatgtcccattactgccctccttggattatgagaaa
ctgaagaaggatttgattttggggagtgaccgcttgaaagccttcttgttgcaggctctg
cgctggcgcttgaccacatcccatcctggagagcagagggagaccgttctgcaagcctac
atcagcaatgacctcttggactgttatagccacaaccagaggagtgtgcttcagttgctg
cactccacgagcgacgtggtgcggcagtacatggccaggctcatcaatgcttttgcgtca
ctggcagaaggtcgcctctaccttgcccagaacacaaaggtgctgcagatgctggaggga
aggctgaaggaggaggacaaggatatcatcaccagggagaatgttcttggggccctgcag
aagttcagtctcaggcgcccgctgcagacagcgatgattcaagacggcctcatcttctgg
ctggttgatgttctgaaggaccctgactgcctgtctgactacacgctggagtactcggtg
gctttgctcatgaacctctgcctccgcagcacagggaagaacatgtgtgccaaggtggca
ggcctcgtgctcaaagtcctttcggatcttcttggccatgaaaaccatgagatacagccg
tatgtgaatggagctctgtacagcatcctttctgttccatccattcgtgaggaagcaaga
gcaatgggaatggaagacatcctacgctgcttcatcaaagaaggcaatgctgaaatgatc
cgccagatagaattcatcatcaagcagctaaattccgaagagctaccagatggtgttctt
gaatctgatgatgatgaagatgaagatgatgaagaggaccatgacatcatggaagccgat
ctggacaaagacgaactgatccagccccagctcggagaactctcaggagagaagcttctg
accacggagtacctggggatcatgaccaacacggggaagacaaggcggaaggggctggct
aatgtgcagtggagcggggatgagcccctgcaaaggcccgtcacccccggcggccacaga
aacgggtacccagtgtaa

DBGET integrated database retrieval system