KEGG   Homo sapiens (human): 80216Help
Entry
80216             CDS       T01001                                 

Gene name
ALPK1, 8430410J10Rik, LAK
Definition
(RefSeq) alpha kinase 1
  KO
K08868  alpha-kinase
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    80216 (ALPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   80216 (ALPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase
Motif
Other DBs
NCBI-GeneID: 80216
NCBI-ProteinID: NP_001095876
OMIM: 607347
HGNC: 20917
Ensembl: ENSG00000073331
Vega: OTTHUMG00000132911
Pharos: Q96QP1(Tbio)
UniProt: Q96QP1
Structure
PDB: 

Position
4q25
AA seq 1244 aa AA seqDB search
MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWP
FVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYG
LDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGT
WLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLG
ILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAV
NIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFG
LTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQ
VQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNE
QKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWT
HSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNY
HVDDRSARKEPGKEHLVDTQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEP
SQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRNTSAHSRPSYRSA
SWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKA
SPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVA
EQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPV
LSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVS
LPGKMRKEILEARTLQPDDFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSK
KSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKDYKEQKGLWHHFT
DVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVK
LSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSV
DQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaaaaagtggtagctgtgctactgcaagagtgcaagcaagtgctggatcag
ctcttgttggaagcgccagatgtgtcggaagaggacaagagcgaggaccagcgctgcaga
gctttactccccagcgagttaaggaccctgatccaggaggcaaaggaaatgaagtggccc
ttcgtgcctgaaaagtggcagtacaaacaagccgtgggcccagaggacaaaacaaacctg
aaggatgtgattggcgccgggttgcagcagttactggcgtccctgagggcctccatcctc
gctcgggactgtgcggctgcggcggctattgtgttcttggtggaccggttcctgtatggg
ctcgacgtctctggaaaacttctgcaggtcgccaaaggtctccacaagttgcagccagcc
acgccaattgccccgcaggtggttattcgccaagcccgaatctccgtgaactcaggaaaa
cttttaaaagcagagtatattctgagcagtctaataagcaacaatggagcaacgggtacc
tggctgtacagaaatgaaagtgacaaggtcctggtgcagtcggtctgtatacagatcaga
gggcagattctgcaaaagctggggatgtggtacgaagcagcagagttaatatgggcctcc
attgtaggatatttggcacttcctcagccggataaaaagggcctctccacgtcgctaggt
atactggcagacatctttgtttccatgagcaagaacgattatgaaaagtttaaaaacaat
ccacaaattaatttgagcctgctgaaggagtttgaccaccatttgctgtccgctgcagaa
gcctgcaagctggcagctgccttcagtgcctatacgccgctcttcgtgctcacagctgtg
aatatccgtggcacgtgtttattgtcctacagtagttcaaatgactgtcctccagaattg
aaaaacttacatctgtgtgaagccaaagaggcctttgagattggcctcctcaccaagaga
gatgatgagcctgttactggaaaacaggagcttcacagctttgtcaaagctgctttcggt
ctcaccacagtgcacagaaggctccatggggagacagggacggtccatgcagcaagtcag
ctctgtaaggaagcaatggggaagctgtacaatttcagcacttcctccagaagtcaggac
agagaagctctgtctcaagaagttatgtctgtgattgcccaggtgaaggaacatttacaa
gttcaaagcttctcaaatgtagatgacagatcttatgttcccgagagtttcgagtgcagg
ttggataaacttatcttgcatgggcaaggggatttccaaaaaatccttgacacctattca
cagcaccatacttcggtgtgtgaagtatttgaaagtgattgtggaaacaacaaaaatgaa
cagaaagatgcaaaaacaggagtctgcatcactgctctaaaaacagaaataaaaaacata
gatactgtgagtactactcaagaaaagccacattgtcaaagagacacaggaatatcttcc
tccctaatgggtaagaatgttcagagggaactcagaaggggaggaaggagaaactggacc
cattctgatgcatttcgagtctccttggatcaagatgtggagactgagactgagccatcg
gactacagcaatggtgagggagctgttttcaacaagtctctgagtggcagccagacttcc
agtgcttggagcaacttatcagggtttagttcctctgcaagctgggaggaagtgaattat
cacgttgacgacaggtcagccagaaaagagcctggcaaagaacatctggtggacactcag
tgttccactgccttgtctgaggagctagagaatgacagggaaggcagagctatgcattca
ttgcattcacagcttcatgatctctctcttcaggaacccaacaatgacaatttggagcct
tctcaaaatcagccacagcaacagatgcccttgacacccttctcgcctcataatacccca
ggcattttcttggcccctggtgcagggcttctagaaggagctccagaaggtatccaggaa
gtcagaaatatgggacccagaaatacttctgctcactccagaccctcatatcgttctgct
tcttggtcttctgattctggtaggcccaagaatatgggcacacatccttcagtccaaaaa
gaagaagcctttgaaataattgttgagtttccagaaaccaactgcgatgtcaaagacagg
caggggaaagagcagggagaagaaattagtgaaagaggcgcaggccctacatttaaagct
agtccctcctgggttgacccagaaggagaaacagcagaaagcactgaagatgcaccctta
gactttcacagggtcctgcacaattctctgggaaacatttccatgctgccatgtagctcc
ttcacccctaattggcctgttcaaaatcctgactccagaaaaagtggtggcccagtcgca
gagcagggcatcgaccctgatgcctccacagtggatgaggaggggcaactgctcgacagc
atggatgttccctgcacaaatgggcacggctctcatagactgtgcattctgagacagccg
cctggtcagagggcggagacccccaattcctctgtaagcggtaacatcctcttccctgtc
ctcagcgaggactgcactaccacagaggaaggaaatcagcctggaaacatgctaaactgc
agccagaactccagctcatcctcagtgtggtggctgaaatcacctgcattttccagtggt
tcttctgagggggacagcccttggtcctatctgaattccagtgggagttcttgggtttca
ttgccgggaaagatgaggaaagagatccttgaggctcgcaccttgcaacctgatgacttt
gaaaagctgttggcaggagtgaggcatgattggctgtttcagagactagagaatacgggg
gtttttaagcccagtcaactccaccgagcacatagtgctcttttgttaaaatattcaaaa
aaatctgaactgtggacggcccaggaaactattgtctatttgggggactacttgactgtg
aagaaaaaaggcagacaaagaaatgctttttgggttcatcatcttcatcaagaagaaatt
ctggggaggtatgttgggaaagactataaggagcagaaggggctctggcaccacttcact
gatgtggagcgacagatgaccgcacagcactatgtgacagaatttaacaagagactctat
gaacaaaacattcccacccagatattctacatcccatccacaatactactgattttagag
gacaagacaataaagggatgtatcagtgtggagccttacatactgggagaatttgtaaaa
ttgtcaaataacacgaaagtggtgaaaacagaatacaaagccacagaatatggcttggcc
tatggccatttttcttatgagttttctaatcatagagatgttgtggtcgatttacaaggt
tgggtaaccggtaatggaaaaggactcatctacctcacagatccccagattcactccgtt
gatcagaaagttttcactaccaattttggaaagagaggaattttttacttctttaataac
cagcatgtggaatgtaatgaaatctgccatcgtctttctttgactagaccttcaatggag
aaaccatgcacatag

DBGET integrated database retrieval system