KEGG   Homo sapiens (human): 80219Help
Entry
80219             CDS       T01001                                 

Gene name
COQ10B
Definition
(RefSeq) coenzyme Q10B
  KO
K18588  coenzyme Q-binding protein COQ10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    80219 (COQ10B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Polyketide_cyc DUF1857
Motif
Other DBs
NCBI-GeneID: 80219
NCBI-ProteinID: NP_079423
HGNC: 25819
Ensembl: ENSG00000115520
Vega: OTTHUMG00000132745
Pharos: Q9H8M1(Tdark)
UniProt: Q9H8M1
Position
2q33.1
AA seq 238 aa AA seqDB search
MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEIC
ARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGY
CKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTL
DFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEVHHT
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcggactggtcatacggccttgagaagggtagtctcgggatgccgtccgaag
tcggcgacagcggccggggcgcaggcgcccgtgcggaatggcagatatttagcttcctgt
ggtatactgatgagcagaactcttccactacatacctcaattttgcctaaggagatatgt
gcacgaactttcttcaaaatcactgcaccattaataaacaaaaggaaagaatattcagag
agaagaattttaggatattcaatgcaggaaatgtatgatgtagtatcgggagtggaggat
tacaagcattttgttccttggtgcaaaaaatcagatgttatatcaaagagatctggatat
tgtaaaacaagattagaaattggatttccacctgtgttggagcgatatacatcagtagta
accttggtgaaacctcatttagtaaaggcatcttgtactgatgggagacttttcaatcat
ttggagactatttggcgttttagcccaggtcttcctggctacccaagaacttgtaccttg
gatttttcaatttcttttgaatttcgatcacttctacattcccagcttgccacactcttt
tttgatgaagttgtgaagcagatggtagctgcctttgaaagaagagcatgtaagctgtat
ggtccagaaacaaatatacctcgggagttaatgcttcatgaagtccatcacacataa

DBGET integrated database retrieval system