KEGG   Homo sapiens (human): 8022Help
Entry
8022              CDS       T01001                                 

Gene name
LHX3, CPHD3, LIM3, M2-LHX3
Definition
(RefSeq) LIM homeobox 3
  KO
K09374  LIM homeobox protein 3/4
Organism
hsa  Homo sapiens (human)
Disease
H00254  Growth hormone deficiency
H02036  Combined pituitary hormone deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8022 (LHX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    8022 (LHX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN DUF3480 Furin-like_2
Motif
Other DBs
NCBI-GeneID: 8022
NCBI-ProteinID: NP_835258
OMIM: 600577
HGNC: 6595
Ensembl: ENSG00000107187
Vega: OTTHUMG00000020924
Pharos: Q9UBR4(Tbio)
UniProt: Q9UBR4 F1T0D5
Position
9q34.3
AA seq 397 aa AA seqDB search
MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSD
CHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVV
CKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGL
AGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRV
LAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaaacggggctcgagcgcgaccgagcgaggcccggggccgccgccgtctgc
accttgggcgggactcgggagatcccgctgtgcgctggctgtgaccagcacatcctggac
cgcttcatcctcaaggctctggaccgccactggcacagcaagtgtctcaagtgcagcgac
tgccacacgccactggccgagcgctgcttcagccgaggggagagcgtttactgcaaggac
gactttttcaagcgcttcgggaccaagtgcgccgcgtgccagctgggcatcccgcccacg
caggtggtgcgccgcgcccaggacttcgtgtaccacctgcactgctttgcctgcgtcgtg
tgcaagcggcagctggccacgggcgacgagttctacctcatggaggacagccggctcgtg
tgcaaggcggactacgaaaccgccaagcagcgagaggccgaggccacggccaagcggccg
cgcacgaccatcaccgccaagcagctggagacgctgaagagcgcttacaacacctcgccc
aagccggcgcgccacgtgcgcgagcagctctcgtccgagacgggcctggacatgcgcgtg
gtgcaggtttggttccagaaccgccgggccaaggagaagaggctgaagaaggacgccggc
cggcagcgctgggggcagtatttccgcaacatgaagcgctcccgcggcggctccaagtcg
gacaaggacagcgttcaggaggggcaggacagcgacgctgaggtctccttccccgatgag
ccttccttggcggaaatgggcccggccaatggcctctacgggagcttgggggaacccacc
caggccttgggccggccctcgggagccctgggcaacttctccctggagcatggaggcctg
gcaggcccagagcagtaccgagagctgcgtcccggcagcccctacggtgtccccccatcc
cccgccgccccgcagagcctccctggcccccagcccctcctctccagcctggtgtaccca
gacaccagcttgggccttgtgccctcgggagcccccggcgggcccccacccatgagggtg
ctggcagggaacggacccagttctgacctatccacggggagcagcgggggttaccccgac
ttccctgccagccccgcctcctggctggatgaggtagaccacgctcagttctga

DBGET integrated database retrieval system