KEGG   Homo sapiens (human): 80273
Entry
80273             CDS       T01001                                 

Gene name
GRPEL1, GrpE, HMGE, mt-GrpE#1
Definition
(RefSeq) GrpE like 1, mitochondrial
  KO
K03687  molecular chaperone GrpE
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    80273 (GRPEL1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    80273 (GRPEL1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP24
   80273 (GRPEL1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    80273 (GRPEL1)
SSDB
Motif
Pfam: GrpE THP2 DUF2408 Phage_int_SAM_6 Sec34
Other DBs
NCBI-GeneID: 80273
NCBI-ProteinID: NP_079472
OMIM: 606173
HGNC: 19696
Ensembl: ENSG00000109519
Vega: OTTHUMG00000090495
Pharos: Q9HAV7(Tbio)
UniProt: Q9HAV7
Position
4p16.1
AA seq 217 aa
MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTL
LEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEK
ATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFH
TPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcggctcagtgcgtgaggttggcgcggcgcagtcttcctgctttggcgttgtctctc
aggccatctccccggttgttgtgcacagccacgaaacaaaagaacagtggccagaacctg
gaagaggacatgggtcagagtgaacagaaggcagatcctcctgctacagagaagaccctc
ctggaagagaaggtcaagttggaggaacagctgaaggagactgtggaaaaatataaacga
gctttggcagacactgagaacttacggcagaggagccagaaattggtggaggaggcaaaa
ttatacggcattcaagccttctgcaaggacttgttggaggtggcagacgttctggagaag
gcaacacagtgtgttccaaaagaagaaattaaagacgataaccctcacctgaagaacctc
tatgaggggctggtcatgactgaagtccagatccagaaggtgttcacaaagcatggcttg
ctcaagttgaaccctgtcggagccaagttcgacccttatgaacatgaggccttgttccac
acaccggttgaggggaaggagccaggcacagtggccctagttagcaaagtggggtacaag
ctgcatgggcgcactctgagacccgccctggtgggggtggtgaaggaagcttag

DBGET integrated database retrieval system