KEGG   Homo sapiens (human): 80274Help
Entry
80274             CDS       T01001                                 

Gene name
SCUBE1
Definition
(RefSeq) signal peptide, CUB domain and EGF like domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FXa_inhibition cEGF Ephrin_rec_like EGF_CA EGF_3 CUB EGF hEGF
Motif
Other DBs
NCBI-GeneID: 80274
NCBI-ProteinID: NP_766638
OMIM: 611746
HGNC: 13441
Ensembl: ENSG00000159307
Vega: OTTHUMG00000150679
Pharos: Q8IWY4(Tbio)
UniProt: Q8IWY4 A0JP65 Q86TI6 Q6ZS56
Position
22q13.2
AA seq 988 aa AA seqDB search
MGAAAVRWHLCVLLALGTRGRLAGGSGLPGSVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQKYALHSDGRT
CIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNT
VGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYILYGTTHC
GDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHWNGKDCVETGKCLSRAKTSPRAQLS
CSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAP
TTPIKQKARFKIRDAKCHLRPHSQARAKETARQPLLDHCHVTFVTLKCDSSKKRRRGRKS
PSKEVSHITAEFEIETKMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSG
TEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVSCMPGTYQDMEGQ
LSCTPCPSSDGLGLPGARNVSECGGQCSPGFFSADGFKPCQACPVGTYQPEPGRTGCFPC
GGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGNT
STDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHIAPPPKRRILIVV
PEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSG
KGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYT
AQESKEMFPRSFIKLLRSKVSRFLRPYK
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggccgtgcgctggcacttgtgcgtgctgctggccctgggcacacgcggg
cggctggccgggggcagcgggctcccagggtcagtcgacgtggatgagtgctcagagggc
acagatgactgccacatcgatgccatctgtcagaacacgcccaagtcctacaaatgcctc
tgcaagccaggctacaagggggaaggcaagcagtgtgaagacattgacgagtgtgagaat
gactactacaatgggggctgtgtccacgagtgcatcaacatcccggggaactacaggtgt
acctgctttgatggcttcatgctggcacacgatggacacaactgcctggatgtggacgag
tgtcaggacaataatggtggctgccagcagatctgcgtcaatgccatgggcagctacgag
tgtcagtgccacagtggcttcttccttagtgacaaccagcatacctgcatccaccgctcc
aatgagggtatgaactgcatgaacaaagaccatggctgtgcccacatctgccgggagacg
cccaaaggtggggtggcctgcgactgcaggcccggctttgaccttgcccaaaaccagaag
gactgcacactaacctgtaattatggaaacggaggctgccagcacagctgtgaggacaca
gacacaggccccacgtgtggttgccaccagaagtacgccctccactcagacggtcgcacg
tgcatcgagacgtgcgcagtcaataacggaggctgcgaccggacatgcaaggacacagcc
actggcgtgcgatgcagctgccccgttggattcacactgcagccggacgggaagacatgc
aaagacatcaacgagtgcctggtcaacaacggaggctgcgaccacttctgccgcaacacc
gtgggcagcttcgagtgcggctgccggaagggctacaagctgctcaccgacgagcgcacc
tgccaggacatcgacgagtgctccttcgagcggacctgtgaccacatctgcatcaactcc
ccgggcagcttccagtgcctgtgtcaccgcggctacatcctctacgggacaacccactgc
ggagatgtggacgagtgcagcatgagcaacgggagctgtgaccagggctgcgtcaacacc
aagggcagctacgagtgcgtctgtcccccggggaggcggctccactggaacgggaaggat
tgcgtggagacaggcaagtgtctttctcgcgccaagacctccccccgggcccagctgtcc
tgcagcaaggcaggcggtgtggagagctgcttcctttcctgcccggctcacacactcttc
gtgccagactcggaaaatagctacgtcctgagctgcggagttccagggccgcagggcaag
gcgctgcagaaacgcaacggcaccagctctggcctcgggcccagctgctcagatgccccc
accacccccatcaaacagaaggcccgcttcaagatccgagatgccaagtgccacctccgg
ccccacagccaggcacgagcaaaggagaccgccaggcagccgctgctggaccactgccat
gtgactttcgtgaccctcaagtgtgactcctccaagaagaggcgccgtggccgcaagtcc
ccatccaaggaggtgtcccacatcacagcagagtttgagatcgagacaaagatggaagag
gcctcagacacatgcgaagcggactgcttgcggaagcgagcagaacagagcctgcaggcc
gccatcaagaccctgcgcaagtccatcggccggcagcagttctatgtccaggtctcaggc
actgagtacgaggtagcccagaggccagccaaggcgctggaggggcagggggcatgtggc
gcaggccaggtgctacaggacagcaaatgcgttgcctgtgggcctggcacccacttcggt
ggtgagctcggccagtgtgtgtcatgtatgccaggaacataccaggacatggaaggccag
ctcagttgcacaccgtgccccagcagcgacgggcttggtctgcctggtgcccgcaacgtg
tcggaatgtggaggccagtgttctccaggcttcttctcggccgatggcttcaagccctgc
caggcctgccccgtgggcacgtaccagcctgagcccgggcgcaccggctgcttcccctgt
ggagggggtttgctcaccaaacacgaaggcaccacctccttccaggactgcgaggctaaa
gtgcactgctcccccggccaccactacaacaccaccacccaccgctgcatccgctgcccc
gtcggcacctaccagcccgagtttggccagaaccactgcatcacctgtccgggcaacacc
agcacagacttcgatggctccaccaacgtcacacactgcaaaaaccagcactgcggcggc
gagcttggtgactacaccggctacatcgagtcccccaactaccctggcgactacccagcc
aacgctgaatgcgtctggcacatcgcgcctcccccaaagcgcaggatcctcatcgtggtc
cctgagatcttcctgcccatcgaggatgagtgcggcgatgttctggtcatgaggaagagt
gcctctcccacgtccatcaccacctatgagacctgccagacctacgagaggcccatcgcc
ttcacctcccgctcccgcaagctctggatccagttcaaatccaatgaaggcaacagcggc
aaaggcttccaagtgccctatgtcacctacgatgaggactaccagcaactcatagaggac
atcgtgcgcgatgggcgcctgtacgcctcggagaaccaccaggaaattttgaaagacaag
aagctgatcaaggccctcttcgacgtgctggcgcatccccagaactacttcaagtacaca
gcccaggaatccaaggagatgttcccacggtccttcatcaaactgctgcgctccaaagtg
tctcggttcctgcggccctacaaataa

DBGET integrated database retrieval system