KEGG   Homo sapiens (human): 80303Help
Entry
80303             CDS       T01001                                 

Gene name
EFHD1, MST133, MSTP133, PP3051, SWS2
Definition
(RefSeq) EF-hand domain family member D1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 80303
NCBI-ProteinID: NP_079478
OMIM: 611617
HGNC: 29556
Ensembl: ENSG00000115468
Vega: OTTHUMG00000133263
Pharos: Q9BUP0(Tbio)
UniProt: Q9BUP0
Position
2q37.1
AA seq 239 aa AA seqDB search
MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLS
RRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMME
KLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDV
ALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggagctggcgtgcaagctggagcgccggctgcggcgcgaggaggccgag
gagagtggcccccagctggctcccctcggcgccccagccccggagcccaagcccgagccc
gagcctcccgcccgtgcgcccacggccagcgccgacgcggagctgagcgcccagctgagc
cggcggctggacatcaacgagggcgctgcgcggccccggcgctgcagggtcttcaacccc
tacacggagttcccggagttcagccgccgcctcatcaaggacctggagagcatgttcaaa
ctgtatgacgctgggcgggatggcttcatcgacctgatggagctgaagctgatgatggag
aagctgggggccccccagacccacctgggcctgaagagcatgatcaaggaggtggatgag
gacttcgatggcaagctcagcttccgggagttcctgctcattttccacaaggccgcggca
ggggagctgcaggaggacagtgggctgatggcgctggcaaagctttctgagatcgatgtg
gccctggagggtgtcaaaggtgccaagaacttctttgaagccaaggtccaagccttgtca
tcggccagtaagtttgaagcagagttgaaagctgagcaagatgagcggaagcgggaggag
gaggagaggcggctccgccaggcagccttccagaaactcaaggccaacttcaatacatag

DBGET integrated database retrieval system