KEGG   Homo sapiens (human): 80308
Entry
80308             CDS       T01001                                 

Gene name
FLAD1, FAD1, FADS, LSMFLAD, PP591
Definition
(RefSeq) flavin adenine dinucleotide synthetase 1
  KO
K00953  FAD synthetase [EC:2.7.7.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00740  Riboflavin metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    80308 (FLAD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     80308 (FLAD1)
SSDB
Motif
Pfam: MoCF_biosynth PAPS_reduct
Other DBs
NCBI-GeneID: 80308
NCBI-ProteinID: NP_079483
OMIM: 610595
HGNC: 24671
Ensembl: ENSG00000160688
Vega: OTTHUMG00000037416
Pharos: Q8NFF5(Tbio)
UniProt: Q8NFF5
Position
1q21.3
AA seq 587 aa
MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPG
YGPQCPVDLAGPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGD
EILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIG
PTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCTGQP
FRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEA
QAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVE
QASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQ
LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILY
DRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEEEERNSRT
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgggttgggatttgggaacacgtttattccagaggcaggaacaaaggagtcgcttgtca
aggatctggttagagaagactagggtcttcctcgaaggaagcacgcgcacgcctgctctc
ccccattgtcttttctggcttctccaggttccctcgacccaggaccccctgttcccaggc
tatggcccccagtgccctgtagacctggcaggccccccgtgcttgcgacccctatttggg
ggtctgggtggctactggagggccttgcagaggggcagagaaggcaggaccatgacatct
agggcctctgaactttctccggggcgcagcgtgacggctggcatcatcattgttggagat
gagatccttaagggacacactcaggacaccaacaccttctttctgtgccggacactgcgc
tccctaggggtccaggtttgccgagtctcagttgtacctgatgaggtagccaccattgca
gctgaggtcacttctttctccaaccgcttcacccatgtcctcacagcagggggcatcggc
cccactcatgatgatgtgacctttgaggcagtggcacaggcctttggagatgagctgaag
ccacaccccaagttggaagcagccaccaaagccctaggaggggaaggctgggagaagcta
tcattggtgccctcctctgcccgcctgcattatggcacagatccttgcactggtcaacct
ttcagattccctctggtctccgtccgaaacgtctacctcttcccaggcattccagagctg
ctgcggcgggtgctggaggggatgaagggactattccaaaacccagctgttcagttccac
tcaaaggagctatatgtggctgctgatgaagcctccatcgcccccattctggctgaggcc
caggcccactttggacgtaggcttggcctgggttcctaccctgactggggcagcaactac
tatcaggtgaagctgactctagactcagaggaagaaggacccctggaggaatgcttggcc
tacctgactgcccgtttgccccagggatcgctggtcccctacatgcccaacgctgtggag
caggccagtgaggctgtatacaaactcgctgaatcagggtcttctttggggaaaaaggtg
gcaggtgccctacagaccattgagacctccctggctcagtacagcctcacccagctctgt
gtgggcttcaacgggggcaaagactgcactgccctcctgcacctcttccatgcagctgtg
cagaggaaattacctgatgttccaaaccccctccagatcctgtatatccgcagcatctcc
cctttccctgagctggaacagtttctacaggacactatcaagaggtataatctgcagatg
ttggaagctgagggcagcatgaagcaggccctgggtgaactgcaggcacggcacccccag
ctggaggctgtccttatgggcacccgccggactgacccctactcctgtagcctctgccct
ttcagccccactgacccaggctggcccgcattcatgcgcatcaacccactgctggactgg
acctacagagacatctgggattttctgcgtcagctgtttgtcccatactgtatcctgtat
gaccgaggatacacatcactggggagtcgggagaataccgtgcggaacccggccctgaag
tgcctgagcccaggaggacaccccacataccgtccagcctatctactggagaacgaagaa
gaggagcggaactcccgcacatga

DBGET integrated database retrieval system