KEGG   Homo sapiens (human): 80315Help
Entry
80315             CDS       T01001                                 

Gene name
CPEB4, CPE-BP4, hCPEB-4
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 4
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    80315 (CPEB4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    80315 (CPEB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    80315 (CPEB4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     80315 (CPEB4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     80315 (CPEB4)
   mRNA cycle factors
    P-body specific factors
     80315 (CPEB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Motif
Other DBs
NCBI-GeneID: 80315
NCBI-ProteinID: NP_085130
OMIM: 610607
HGNC: 21747
Ensembl: ENSG00000113742
Vega: OTTHUMG00000130541
Pharos: Q17RY0(Tbio)
UniProt: Q17RY0
Structure
PDB: 

Position
5q35.2
AA seq 729 aa AA seqDB search
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQG
DNSSENGNGKEKIRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLP
PDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDG
KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIM
DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPY
VLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDR
PRHISFRWN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtcagattccatccacatctgcagcctccacaccatcaccaaaatgccacccccagc
cctgctgcttttataaataataacacagctgccaatggcagcagtgctgggtcagcttgg
ctttttcctgctccagctacccataacattcaggatgagatcttggggtcagaaaaagca
aaaagtcagcaacaggaacagcaagaccccttagaaaagcagcagctttccccaagtcca
ggtcaggaagctggaatactgcctgaaacagagaaggcaaaatcagaagaaaatcaaggg
gacaattcttcggaaaatggcaatgggaaggagaaaataaggatcgaatctccagtgttg
acagggtttgattatcaagaagccactgggctaggtacttcaacccaacccttgacatct
agcgcatcgtctcttactggtttcagtaactggtcagcagcgatagcgccttcctcctct
acaataatcaatgaagatgcaagtttctttcaccagggaggggtccctgctgcttcggct
aataacggtgctctgttgtttcaaaatttcccccatcatgtcagccctggctttggaggc
agcttctctcctcagatcgggcctctctcacagcaccacccacatcaccctcatttccag
catcatcacagccagcatcagcagcaaaggaggtctcctgccagtccccatcccccaccc
ttcacacatagaaatgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cccccctctccgtggagcagctaccagagtccgtcaccaacaccctcctcttcctggagc
ccgggcggtggtggatatggtggctggggaggttcccaaggccgagatcaccgcagaggg
ctgaatggtggaataacgcccctgaactccatctcgcctttgaagaaaaattttgcaagc
aatcatattcagctccagaagtatgctcgccccagctctgcctttgcacctaaatcctgg
atggaagatagcttgaacagggctgacaacatttttccttttccggatcgccccaggaca
ttcgacatgcactcactggagagttcactcattgacataatgagagctgaaaatgatacc
attaaaggtcgtctaaactattcatatccaggatccgatagctctctgcttattaatgca
aggacatatgggcgaaggagaggtcagtcttcactgtttccaatggaagatggattcttg
gatgatggccgtggggatcagcctcttcatagtggcctgggttcacctcactgcttcagt
caccagaatggggaaagagtggaacgatattctcgaaaggtgtttgtaggcggattgcct
ccagacattgatgaagatgagatcacagctagttttcgtcgctttggccctctgattgtg
gattggcctcataaagctgagagcaaatcctattttcctcctaaaggctatgcattcctg
ctgtttcaagatgaaagctctgtgcaggctctcattgatgcatgcattgaagaagatgga
aaactctacctttgtgtatcaagtcccactatcaaggataagccagtccagattcggcct
tggaatctcagtgacagtgactttgtgatggatggttcacagccacttgacccacgaaaa
actatatttgttggtggtgttcctcgaccattacgagctgtggagcttgcgatgataatg
gatcggctatatggaggtgtgtgctacgctgggattgataccgaccctgagctaaaatac
ccaaaaggagctgggagagttgcgttctctaatcaacagagttacatagctgctatcagt
gcccgctttgttcagctgcagcatggagagatagataaacgggtggaagttaagccatat
gtcttggatgatcagctgtgtgatgaatgtcagggggcccgttgtggggggaaatttgct
ccatttttctgtgctaatgttacctgtctgcagtattactgtgaatattgctgggctgct
atccattctcgtgctggcagggaattccacaagcccctggtgaaggaaggcggtgaccgc
cctcggcatatttcattccgctggaactaa

DBGET integrated database retrieval system