KEGG   Homo sapiens (human): 80316
Entry
80316             CDS       T01001                                 
Symbol
PPP1R2C, I-4, PPP1R2P9
Name
(RefSeq) PPP1R2C family member C
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: IPP-2
Other DBs
NCBI-GeneID: 80316
NCBI-ProteinID: NP_079486
OMIM: 301017
HGNC: 16324
Ensembl: ENSG00000102055
Vega: OTTHUMG00000021382
Position
X:complement(42777366..42778163)
AA seq 202 aa
MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATY
RDYDLMKANEPGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSE
AYMRKILLHKQEKKRQFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEK
TAAEESEEAPLTGGLQTQSCDP
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtcagcctccacctcctcgcaccggcccatcaaggggatcctgaaaaacaaaagctcg
tcgggttcctcggtggcgacttccggtcagcagtctggagggactattcaagatgtgaag
agaaagaaatcccaaaagtgggacgaatcaagcatccttgcggcacaccgcgcaacgtac
agagattacgatttaatgaaggcaaatgagcccggcacttcctacatgagtgtgcaagat
aatggggaagattcagtgcgcgatgtcgaaggagaagattcagtgcgtggtgtcgaagga
aaggaagccaccgatgcttccgaccacagctgtgaggtggacgagcaagagagcagtgag
gcctacatgagaaaaatcctcctccacaaacaggagaaaaagcggcagttcgaaatgaga
agaaggcttcactacaacgaagaattgaacatcaaattagctagacaattaatgtggaaa
gagctacaaagtgaagataatgaaaacgaagaaacgccacaaggcacgaacgaagagaag
actgctgcggaagaatcagaggaagctcctctgaccggtggactgcaaacccagtcatgc
gacccttag

DBGET integrated database retrieval system