KEGG   Homo sapiens (human): 80318Help
Entry
80318             CDS       T01001                                 

Gene name
GKAP1, FKSG21, GKAP42
Definition
(RefSeq) G kinase anchoring protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 80318
NCBI-ProteinID: NP_079487
OMIM: 611356
HGNC: 17496
Ensembl: ENSG00000165113
Vega: OTTHUMG00000020106
Pharos: Q5VSY0(Tdark)
UniProt: Q5VSY0
Position
9q21.32
AA seq 366 aa AA seqDB search
MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRR
KKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQ
LTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVS
LKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCT
AHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEG
EMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNS
ESDQCR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagcagtacttagttctgttcccaccaccgcttctcgttttgccctgttacaa
gtggatagtggcagtggctctgattctgaacctggaaaaggtaaaggtcgaaatactgga
aagtctcaaactttaggaagcaagtcaactacaaatgagaaaaaaagagagaaaagaaga
aaaaagaaggaacagcaacagagtgaagcaaatgagctcaggaatcttgcttttaagaaa
attccccagaaatcctcccatgctgtttgtaacgctcaacatgatcttccattgtcaaac
ccagtacagaaggattcacgagaagaaaattggcaagagtggagacaaagagatgagcag
ctgacatctgaaatgtttgaagcagatcttgagaaggcattgttactaagtaaactagaa
tatgaagagcacaaaaaggagtatgaagatgctgaaaatacttcaactcagtccaaagtt
atgaataaaaaagataaaagaaagaatcatcagggaaaagacagacctctcacagtatca
ctaaaagattttcattcggaagatcacattagtaaaaagactgaggaattgagttcttct
cagactttatcacatgatggaggattcttcaatagactggaagatgatgttcataaaatt
cttattagagaaaaacgaagagaacagcttacagaatataatggaacagataattgtaca
gctcatgaacacaaccaggaagtggttctgaaagatggaagaattgaaagactaaagtta
gagcttgaaaggaaagatgctgaaatccagaagctgaaaaatgtaatcactcaatgggag
gcaaagtataaggaagtaaaggcaagaaatgcacaattattgaaaatgcttcaggaaggt
gaaatgaaagataaggcagaaatacttctgcaagttgatgaatcacaaagtatcaagaat
gagctcactattcaggtgacttcacttcatgctgcattagaacaagaaagatctaaagtg
aaagtattacaagcagagttagccaaataccagggtggcagaaaagggaaaagaaactct
gaatccgaccagtgtaggtga

DBGET integrated database retrieval system