KEGG   Homo sapiens (human): 80319
Entry
80319             CDS       T01001                                 

Symbol
CXXC4, IDAX
Name
(RefSeq) CXXC finger protein 4
  KO
K03344  Dvl-binding protein IDAX
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    80319 (CXXC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    80319 (CXXC4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    80319 (CXXC4)
SSDB
Motif
Pfam: zf-CXXC
Other DBs
NCBI-GeneID: 80319
NCBI-ProteinID: NP_079488
OMIM: 611645
HGNC: 24593
Ensembl: ENSG00000168772
Vega: OTTHUMG00000131121
UniProt: J9JIF5
Structure
PDB: 
5VC9

Position
4q24
AA seq 367 aa
MNTNVCVEPGPSPEAPGLPKESHLPEGALNSLVDYNSEMERYRSFATSFYKTNGGAFPQA
AKIARITTPIFPSSAAAAAAAARIGMSPWNCDNAATAAAATAMLWGSGGGGGGGGGGGGG
GGGGGGGGGGGGGGRKSSSAAASSSASSSSAILPAGGGGGGGGGGSRTSMHHRNDSQRLG
KAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIP
ALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANP
AKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSA
EAFRWFF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaacaccaatgtctgcgtggagcccgggccgagcccggaggccccgggcttgcccaag
gaaagccacttgcccgagggggctctgaacagccttgtggattacaactcggaaatggag
cgctaccgctcctttgccacctccttctacaagaccaacgggggcgccttcccacaggcg
gccaagatcgcgcgcatcaccacccccatcttccccagcagcgccgccgccgccgcggcc
gccgcgcgcatcggcatgtccccctggaactgcgacaacgcggccaccgccgccgccgcc
accgccatgctctggggcagcggcgggggcgggggcggcggcggggggggtggcggcggc
ggcggcggcggcggaggcgggggcgggggtggtgggggcggcaggaaatcctcctccgcc
gccgcctcctcctccgcctcctcctcctcggcgatcctccccgccggcggtggcggcggc
ggcggcggcggcggcagcaggaccagcatgcaccaccgaaacgactcccagaggctgggg
aaagctggctgcccgccagagccgtcgttgcaaatggcaaatactaatttcctctccacc
ttatcccctgaacactgcagacctttggcgggggaatgcatgaacaagctcaaatgcggc
gctgctgaagcagagataatgaatctccccgagcgcgtggggactttttccgctatcccg
gctttagggggcatctcattacctccaggggtcatcgtcatgacagcccttcactccccc
gcagcagcctcagcagccgtcacagacagtgcgtttcaaattgccaatctggcagactgc
ccgcagaatcattcctcctcctcctcgtcctcctcagggggagctggcggagccaaccca
gccaagaagaagaggaaaaggtgtggggtctgcgtgccctgcaagaggctcatcaactgt
ggcgtctgcagcagttgcaggaaccgcaaaacgggacaccagatctgcaaatttagaaaa
tgtgaagagctaaagaaaaaacctggcacttcactagagagaacacctgttcccagcgct
gaagcattccgatggttcttttaa

DBGET integrated database retrieval system