KEGG   Homo sapiens (human): 80331Help
Entry
80331             CDS       T01001                                 

Gene name
DNAJC5, CLN4, CLN4B, CSP, DNAJC5A, NCL, mir-941-2, mir-941-3, mir-941-4, mir-941-5
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00149  Neuronal ceroid lipofuscinosis (NCL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80331 (DNAJC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    80331 (DNAJC5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   80331 (DNAJC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ Baculo_F EMP70
Motif
Other DBs
NCBI-GeneID: 80331
NCBI-ProteinID: NP_079495
OMIM: 611203
HGNC: 16235
Ensembl: ENSG00000101152
Vega: OTTHUMG00000033007
Pharos: Q9H3Z4(Tbio)
UniProt: Q9H3Z4 Q6AHX3
Structure
PDB: 

Position
20q13.33
AA seq 198 aa AA seqDB search
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagacagcgctcactgtctacctctggggagtcattgtaccacgtcctt
gggttggacaagaacgcaacctcagatgacattaaaaagtcctatcggaagcttgccttg
aaatatcaccccgacaagaaccccgacaacccggaggccgcggacaagtttaaggagatc
aacaacgcgcacgccatcctcacggacgccacaaaaaggaacatctacgacaagtacggc
tcgctgggtctctacgtggccgagcagtttggggaagagaacgtgaacacctacttcgtg
ctgtccagctggtgggccaaggccctgtttgtcttctgcggcctcctcacgtgctgctac
tgctgctgctgtctgtgctgctgcttcaactgctgctgcgggaagtgtaagcccaaggcg
cctgaaggcgaggagacggagttctacgtgtcccccgaggatctggaggcacagctgcag
tctgacgagagggaggccacagacacgccgatcgtcatacagccggcatccgccaccgag
accacccagctcacagccgactcccaccccagctaccacactgacgggttcaactaa

DBGET integrated database retrieval system