KEGG   Homo sapiens (human): 80341Help
Entry
80341             CDS       T01001                                 

Gene name
BPIFB2, BPIL1, C20orf184, LPLUNC2, RYSR, dJ726C3.2
Definition
(RefSeq) BPI fold containing family B member 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Motif
Other DBs
NCBI-GeneID: 80341
NCBI-ProteinID: NP_079503
OMIM: 614108
HGNC: 16177
Ensembl: ENSG00000078898
Vega: OTTHUMG00000032232
Pharos: Q8N4F0(Tdark)
UniProt: Q8N4F0
Position
20q11.21
AA seq 458 aa AA seqDB search
MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWS
GEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADT
RVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNL
VQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT
PFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRL
IPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDV
VVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNA
LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggcaagtaggctgggcctgctgctggcactgctgctgcccgtggtcggtgcc
tccacgccaggcaccgtggtccgactcaacaaggcagcattgagctacgtgtctgaaatt
gggaaagcccctctccagcgggccctgcaggtcactgtccctcatttcctggactggagt
ggagaggcgcttcagcccaccaggatccggattctgaatgtccatgtgccccgcctccac
ctgaaattcattgctggtttcggagtgcgcctgctggcagcagctaattttactttcaag
gtctttcgcgccccagagcccctggagctgacgctgcctgtggaactgctggctgacacc
cgcgtgacccagagctccatcaggacccctgtggtcagcatctctgcctgctctttattc
tcgggccacgccaacgagtttgatggcagtaacagcacctcccacgcgctgctggtcctg
gtgcagaagcacattaaagctgtcttgagtaacaagctgtgcctgagcatctccaacctg
gtgcagggtgtcaatgtccacctgggcaccttaattggcctcaaccccgtgggtcctgag
tcccagatccgctattccatggtcagtgtgcccactgtcaccagtgactacatttccctg
gaagtcaatgctgttctcttcctgctgggcaagcccatcatcctgcccacggatgccacc
ccttttgtgttgccaaggcatgtgggtaccgagggctccatggccaccgtgggcctctcc
cagcagctgtttgactctgcgctcctgctgctgcagaaggccggtgccctcaacctggac
atcacagggcagctgaggtcggatgacaacctgctgaacacctctgctctgggccggctc
atcccggaggtggcccgccagtttcccgagcccatgcctgtggtgctcaaggtgcggctg
ggtgccacacctgtggccatgctccacacaaacaacgccaccctgcggctgcagcccttc
gtggaggtcctggccacagcctccaactcggctttccagtccctcttctccctggatgtg
gtagtgaacttgagactccagctctctgtgtccaaggtgaagcttcaggggaccacgtct
gtgctgggggatgtccagctcacggtggcctcctccaacgtgggcttcattgatacagat
caggtgcgcacactgatgggcaccgtttttgagaagcccctgctggaccatctcaatgct
ctcttggccatgggaattgccctccctggtgtggtcaacctccactatgtcgcccctgag
atctttgtctatgagggctacgtggtgatatccagtggactcttctaccagagctga

DBGET integrated database retrieval system