KEGG   Homo sapiens (human): 80347
Entry
80347             CDS       T01001                                 
Symbol
COASY, DPCK, NBIA6, NBP, PCH12, PPAT, UKR1, pOV-2
Name
(RefSeq) Coenzyme A synthase
  KO
K02318  phosphopantetheine adenylyltransferase / dephospho-CoA kinase [EC:2.7.7.3 2.7.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Disease
H00833  Neurodegeneration with brain iron accumulation
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    80347 (COASY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    80347 (COASY)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     80347 (COASY)
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     80347 (COASY)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    80347 (COASY)
SSDB
Motif
Pfam: CoaE CTP_transf_like AAA_33 AAA_18 APS_kinase PRK
Other DBs
NCBI-GeneID: 80347
NCBI-ProteinID: NP_001035994
OMIM: 609855
HGNC: 29932
Ensembl: ENSG00000068120
Pharos: Q13057(Tbio)
UniProt: Q13057
Position
17:42562148..42566277
AA seq 564 aa
MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQA
TFEVLDFITHLYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQT
LDGSQYNPVKQQLVRYATSCYSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPV
AGSPKQPVRGYYRGAVGGTFDRLHNAHKVLLSVACILAQEQLVVGVADKDLLKSKLLPEL
LQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDPSLEFLVVSEETYRGGMAINR
FRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELPTCLYV
IGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQ
NLVHEVWTAVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHI
TQRQVEKAWALLQKRIPKTHQALD
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggccgtattccggtcgggtctcctggtgctgacgacgccgctggcctccctagcccct
cgcctggcctccatcctgacctcggcggcccggctggtgaatcacacactctatgttcac
ctgcagccgggcatgagcctggagggcccggctcagccccagtccagccccgtgcaggcc
acgtttgaggttcttgatttcatcacgcacctctatgctggcgccgacgtccacaggcac
ttggacgtcagaatcctactgaccaatatccgaaccaagagcacctttctccctcccctg
cccacctcagtccagaatctcgcccacccgccagaagtcgtgttgacagatttccagacc
ctggatggaagccagtacaacccggtcaaacagcagctagtgcgttacgccaccagctgt
tacagctgttgtccgcgactggcctcggtgctgctatactccgattatgggataggagaa
gtgcccgtggagcccctggatgtccccttaccctccacgatcaggccagcttcccccgtg
gccgggtctccaaagcagccggtgcgtggctactaccgtggcgctgtcggtggcacgttt
gaccgcctgcacaacgcccacaaggtgttgctcagtgtcgcgtgcatcctggcccaggag
cagcttgtggtgggagtagcagacaaagatctgttgaagagcaagttgctccctgagctg
ctccaaccttatacagaacgtgtggaacatctgagtgaattcctggtggacatcaagccc
tccttgacttttgatgtcatccccctgctggacccctatgggcccgctggctctgacccc
tccctggagttcctggtggtcagcgaggagacctatcgtggggggatggccatcaaccgc
ttccgccttgagaatgacctggaggaacttgctttgtaccagatccagctgctgaaggac
ctcagacatacagagaatgaagaggacaaagtcagctcctccagcttccgccagcgaatg
ttggggaacctgcttcggcctccatatgaaaggccagagctccccacatgtctctatgta
attgggctgactggcatcagtggctctgggaagagctcaatagctcagcgactgaagggc
ctgggggcgtttgtcattgacagtgaccacctgggtcatcgggcctatgccccaggtggc
cctgcctaccagcctgtggtggaggcctttggaacagatattctccataaagatggcatc
atcaacaggaaggtcctaggcagccgggtgtttgggaataagaagcagctgaagatactc
acggacattatgtggccaattatcgcaaagctggcccgagaggagatggatcgggctgtg
gctgagggaaagcgtgtgtgtgtgattgatgccgctgtgttgcttgaagccggctggcag
aacctggtccatgaggtgtggactgctgtcatcccagagactgaggctgtaagacgcatt
gtggagagggatggcctcagtgaagccgcggctcaaagccggctgcagagccagatgagc
gggcagcagcttgtggaacagagccacgtggtgctcagcaccttgtgggagccgcatatc
acccaacgccaggtggagaaagcctgggccctcttgcagaagcgcattcccaagactcat
caggccctcgactga

DBGET integrated database retrieval system