KEGG   Homo sapiens (human): 80351
Entry
80351             CDS       T01001                                 

Gene name
TNKS2, ARTD6, PARP-5b, PARP-5c, PARP5B, PARP5C, TANK2, TNKL, pART6
Definition
(RefSeq) tankyrase 2
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    80351 (TNKS2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    80351 (TNKS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     80351 (TNKS2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     80351 (TNKS2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     80351 (TNKS2)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank Ank_4 Ank_3 PARP SAM_2 SAM_1
Other DBs
NCBI-GeneID: 80351
NCBI-ProteinID: NP_079511
OMIM: 607128
HGNC: 15677
Ensembl: ENSG00000107854
Vega: OTTHUMG00000018747
Pharos: Q9H2K2(Tchem)
UniProt: Q9H2K2
Structure
PDB: 
5BXO 5BXU 5NWG 5NWD 5NWC 5NVE 4PNL 5JRT 5NVF 5C5R 3TWR 4TJU 5NXE 5NWB 5NVC 5NVH 5NUT 4UVZ 4PNT 4BUU 4BUE 4UI5 4PNS 4TK0 4PNN 4BU9 4UHG 4UFY 4TJW 4L0V 4L10 3TWS 4PNR 5ZQR 5NT0 5C5P 5AL1 5AL3 4UVP 4HLH 3U9H 5OWS 5NSX 5ADS 4UI6 4UI7 5AKU 4UX4 4BUV 4BU5 4BU6 4L34 4L0B 3TWU 3TWX 3MHJ 5NOB 5AEH 4UVO 4PNQ 4BUW 4BU8 4BUA 4L32 3TWT 4Z68 4PML 4BS4 5NT4 5AL2 5AL4 4UVV 4TJY 4BUS 4BUT 4BUY 4L0S 4J3M 3P0N 3P0Q 4J21 4W5I 4UVT 4UVU 4UVX 4UVY 4TKG 4M7B 4BUX 4BUI 4HLM 4HKK 3KR7 6A84 5ZQP 5C5Q 4UI3 4UVS 4UVL 4L31 4KZL 4J1Z 3W51 4HLG 4HLK 3TWW 4TK5 4UI8 5AL5 4BU7 4L2F 4L2G 4L09 4BJ9 4HKN 5ZQO 5AKW 4J3L 5ADQ 5ADR 4UFU 4UVW 4L33 4L2K 4L0T 4KZU 3KR8 4J22 5ADT 4TKI 4BU3 4HLF 4HKI 4AVW 3UA9 3TWQ 4PNM 5OWT 4UVN 4BJC 4HL5 5DCZ 4KZQ 2Y0I 5ZQQ 5NSP 4L0I 4BJB 4HMH 3U9Y 3TWV 3MHK 4IUE 4UI4 4BFP 4AVU 3P0P 4BUD 4BUF 5FPF 4TKF 5FPG 4HYF

Position
10q23.32
AA seq 1166 aa
MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIMRPEGMVDG
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgggtcgccgctgcgccggcgggggagcggcctgcgcgagcgccgcggccgaggcc
gtggagccggccgcccgagagctgttcgaggcgtgccgcaacggggacgtggaacgagtc
aagaggctggtgacgcctgagaaggtgaacagccgcgacacggcgggcaggaaatccacc
ccgctgcacttcgccgcaggttttgggcggaaagacgtagttgaatatttgcttcagaat
ggtgcaaatgtccaagcacgtgatgatgggggccttattcctcttcataatgcatgctct
tttggtcatgctgaagtagtcaatctccttttgcgacatggtgcagaccccaatgctcga
gataattggaattatactcctctccatgaagctgcaattaaaggaaagattgatgtttgc
attgtgctgttacagcatggagctgagccaaccatccgaaatacagatggaaggacagca
ttggatttagcagatccatctgccaaagcagtgcttactggtgaatataagaaagatgaa
ctcttagaaagtgccaggagtggcaatgaagaaaaaatgatggctctactcacaccatta
aatgtcaactgccacgcaagtgatggcagaaagtcaactccattacatttggcagcagga
tataacagagtaaagattgtacagctgttactgcaacatggagctgatgtccatgctaaa
gataaaggtgatctggtaccattacacaatgcctgttcttatggtcattatgaagtaact
gaacttttggtcaagcatggtgcctgtgtaaatgcaatggacttgtggcaattcactcct
cttcatgaggcagcttctaagaacagggttgaagtatgttctcttctcttaagttatggt
gcagacccaacactgctcaattgtcacaataaaagtgctatagacttggctcccacacca
cagttaaaagaaagattagcatatgaatttaaaggccactcgttgctgcaagctgcacga
gaagctgatgttactcgaatcaaaaaacatctctctctggaaatggtgaatttcaagcat
cctcaaacacatgaaacagcattgcattgtgctgctgcatctccatatcccaaaagaaag
caaatatgtgaactgttgctaagaaaaggagcaaacatcaatgaaaagactaaagaattc
ttgactcctctgcacgtggcatctgagaaagctcataatgatgttgttgaagtagtggtg
aaacatgaagcaaaggttaatgctctggataatcttggtcagacttctctacacagagct
gcatattgtggtcatctacaaacctgccgcctactcctgagctatgggtgtgatcctaac
attatatcccttcagggctttactgctttacagatgggaaatgaaaatgtacagcaactc
ctccaagagggtatctcattaggtaattcagaggcagacagacaattgctggaagctgca
aaggctggagatgtcgaaactgtaaaaaaactgtgtactgttcagagtgtcaactgcaga
gacattgaagggcgtcagtctacaccacttcattttgcagctgggtataacagagtgtcc
gtggtggaatatctgctacagcatggagctgatgtgcatgctaaagataaaggaggcctt
gtacctttgcacaatgcatgttcttatggacattatgaagttgcagaacttcttgttaaa
catggagcagtagttaatgtagctgatttatggaaatttacacctttacatgaagcagca
gcaaaaggaaaatatgaaatttgcaaacttctgctccagcatggtgcagaccctacaaaa
aaaaacagggatggaaatactcctttggatcttgttaaagatggagatacagatattcaa
gatctgcttaggggagatgcagctttgctagatgctgccaagaagggttgtttagccaga
gtgaagaagttgtcttctcctgataatgtaaattgccgcgatacccaaggcagacattca
acacctttacatttagcagctggttataataatttagaagttgcagagtatttgttacaa
cacggagctgatgtgaatgcccaagacaaaggaggacttattcctttacataatgcagca
tcttacgggcatgtagatgtagcagctctactaataaagtataatgcatgtgtcaatgcc
acggacaaatgggctttcacacctttgcacgaagcagcccaaaagggacgaacacagctt
tgtgctttgttgctagcccatggagctgacccgactcttaaaaatcaggaaggacaaaca
cctttagatttagtttcagcggatgatgtcagcgctcttctgacagcagccatgccccca
tctgctctgccctcttgttacaagcctcaagtgctcaatggtgtgagaagcccaggagcc
actgcagatgctctctcttcaggtccatctagcccatcaagcctttctgcagccagcagt
cttgacaacttatctgggagtttttcagaactgtcttcagtagttagttcaagtggaaca
gagggtgcttccagtttggagaaaaaggaggttccaggagtagattttagcataactcaa
ttcgtaaggaatcttggacttgagcacctaatggatatatttgagagagaacagatcact
ttggatgtattagttgagatggggcacaaggagctgaaggagattggaatcaatgcttat
ggacataggcacaaactaattaaaggagtcgagagacttatctccggacaacaaggtctt
aacccatatttaactttgaacacctctggtagtggaacaattcttatagatctgtctcct
gatgataaagagtttcagtctgtggaggaagagatgcaaagtacagttcgagagcacaga
gatggaggtcatgcaggtggaatcttcaacagatacaatattctcaagattcagaaggtt
tgtaacaagaaactatgggaaagatacactcaccggagaaaagaagtttctgaagaaaac
cacaaccatgccaatgaacgaatgctatttcatgggtctccttttgtgaatgcaattatc
cacaaaggctttgatgaaaggcatgcgtacataggtggtatgtttggagctggcatttat
tttgctgaaaactcttccaaaagcaatcaatatgtatatggaattggaggaggtactggg
tgtccagttcacaaagacagatcttgttacatttgccacaggcagctgctcttttgccgg
gtaaccttgggaaagtctttcctgcagttcagtgcaatgaaaatggcacattctcctcca
ggtcatcactcagtcactggtaggcccagtgtaaatggcctagcattagctgaatatgtt
atttacagaggagaacaggcttatcctgagtatttaattacttaccagattatgaggcct
gaaggtatggtcgatggataa

DBGET integrated database retrieval system